BLASTX nr result
ID: Glycyrrhiza31_contig00008395
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00008395 (472 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BAT79366.1 hypothetical protein VIGAN_02224200, partial [Vigna a... 53 2e-06 >BAT79366.1 hypothetical protein VIGAN_02224200, partial [Vigna angularis var. angularis] Length = 69 Score = 52.8 bits (125), Expect = 2e-06 Identities = 26/43 (60%), Positives = 30/43 (69%) Frame = -3 Query: 242 GNEVGFLFFLLWNQVLDRTCDTMNRXXXXXXXIRVSQTVHTGK 114 GN+ F FFLLWNQVLDRTCDTM+R +SQT+HT K Sbjct: 28 GNDEKF-FFLLWNQVLDRTCDTMSRSSISKSTKGMSQTIHTRK 69