BLASTX nr result
ID: Glycyrrhiza31_contig00008164
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00008164 (924 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013442832.1 hypothetical protein MTR_0082s0170 [Medicago trun... 106 1e-25 XP_013442833.1 hypothetical protein MTR_0082s0180 [Medicago trun... 83 5e-16 JAV00758.1 hypothetical protein MP_TR24784_c0_g1_i1_g.71748, par... 74 2e-13 >XP_013442832.1 hypothetical protein MTR_0082s0170 [Medicago truncatula] KEH16857.1 hypothetical protein MTR_0082s0170 [Medicago truncatula] Length = 73 Score = 106 bits (264), Expect = 1e-25 Identities = 55/72 (76%), Positives = 59/72 (81%), Gaps = 3/72 (4%) Frame = +3 Query: 627 QP*LERSTCAAGGAERTNPRLASFPKPN*IELLLSKNAC*---KSKKEGPFSHVVRRSNQ 797 QP ERSTCAAGGAERTNPRLASFPKPN I +++ C K +KEGPFSHVVRRSNQ Sbjct: 2 QPQPERSTCAAGGAERTNPRLASFPKPNFINRIVTFKKCLLKIKERKEGPFSHVVRRSNQ 61 Query: 798 RFSSQSYREIFF 833 RFSSQSYREIFF Sbjct: 62 RFSSQSYREIFF 73 >XP_013442833.1 hypothetical protein MTR_0082s0180 [Medicago truncatula] KEH16858.1 hypothetical protein MTR_0082s0180 [Medicago truncatula] Length = 140 Score = 83.2 bits (204), Expect = 5e-16 Identities = 37/41 (90%), Positives = 38/41 (92%) Frame = +1 Query: 247 EGRWLARGPWYLTGHWPPSRYGSLYVPLAIGVSNPRIVRST 369 +G L RGPWYLTGHWPPSRYGSLYVPLAIGVSNPRIVRST Sbjct: 100 DGLELERGPWYLTGHWPPSRYGSLYVPLAIGVSNPRIVRST 140 >JAV00758.1 hypothetical protein MP_TR24784_c0_g1_i1_g.71748, partial [Noccaea caerulescens] Length = 76 Score = 74.3 bits (181), Expect = 2e-13 Identities = 38/51 (74%), Positives = 39/51 (76%), Gaps = 3/51 (5%) Frame = -1 Query: 912 LFWVFLYFYLTG---RKGWFFHCIDRSLTRKRSLYNFEKRIVGLTDELRGK 769 LF V FYLTG RKGWFFHCIDRSLTRK SLY FEKRIVGLTD G+ Sbjct: 16 LFGVSFSFYLTGQTNRKGWFFHCIDRSLTRKGSLYYFEKRIVGLTDGKHGR 66