BLASTX nr result
ID: Glycyrrhiza31_contig00008084
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00008084 (353 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHN14504.1 Pentatricopeptide repeat-containing protein [Glycine ... 57 2e-07 XP_006573403.1 PREDICTED: pentatricopeptide repeat-containing pr... 57 3e-07 XP_017441476.1 PREDICTED: pentatricopeptide repeat-containing pr... 55 3e-06 >KHN14504.1 Pentatricopeptide repeat-containing protein [Glycine soja] Length = 231 Score = 57.4 bits (137), Expect = 2e-07 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = +3 Query: 243 MEINSLALPSCHMPILLNDSRSGPPQQRPKVIWRRN 350 MEINSL+LPSC MPILL DS SG PQQ+ K+IW +N Sbjct: 1 MEINSLSLPSCRMPILLKDSHSGSPQQQNKLIWWQN 36 >XP_006573403.1 PREDICTED: pentatricopeptide repeat-containing protein At3g42630-like [Glycine max] KRH76122.1 hypothetical protein GLYMA_01G132800 [Glycine max] Length = 415 Score = 57.4 bits (137), Expect = 3e-07 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = +3 Query: 243 MEINSLALPSCHMPILLNDSRSGPPQQRPKVIWRRN 350 MEINSL+LPSC MPILL DS SG PQQ+ K+IW +N Sbjct: 1 MEINSLSLPSCRMPILLKDSHSGSPQQQNKLIWWQN 36 >XP_017441476.1 PREDICTED: pentatricopeptide repeat-containing protein At3g42630 [Vigna angularis] BAT97610.1 hypothetical protein VIGAN_09111200 [Vigna angularis var. angularis] Length = 415 Score = 54.7 bits (130), Expect = 3e-06 Identities = 26/36 (72%), Positives = 28/36 (77%) Frame = +3 Query: 243 MEINSLALPSCHMPILLNDSRSGPPQQRPKVIWRRN 350 MEINSL LPS M ILL DS SG PQQ+ K+IWRRN Sbjct: 1 MEINSLTLPSSRMSILLKDSPSGAPQQQNKIIWRRN 36