BLASTX nr result
ID: Glycyrrhiza31_contig00007535
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00007535 (424 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004494045.1 PREDICTED: uncharacterized protein LOC101494039 i... 64 3e-09 XP_007144388.1 hypothetical protein PHAVU_007G152100g [Phaseolus... 55 3e-06 XP_007144389.1 hypothetical protein PHAVU_007G152100g [Phaseolus... 55 4e-06 >XP_004494045.1 PREDICTED: uncharacterized protein LOC101494039 isoform X1 [Cicer arietinum] Length = 330 Score = 63.9 bits (154), Expect = 3e-09 Identities = 31/40 (77%), Positives = 33/40 (82%) Frame = -3 Query: 122 VSSMRYNKAPLTMKIYCFGRNLITASSPSLSPVQLPAQKE 3 +SSMRYNK L M IYCFGRNL+TA S SLSPV LPAQKE Sbjct: 1 MSSMRYNKPRLIMNIYCFGRNLVTAPSCSLSPVHLPAQKE 40 >XP_007144388.1 hypothetical protein PHAVU_007G152100g [Phaseolus vulgaris] ESW16382.1 hypothetical protein PHAVU_007G152100g [Phaseolus vulgaris] Length = 309 Score = 55.1 bits (131), Expect = 3e-06 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = -3 Query: 128 VCVSSMRYNKAPLTMKIYCFGRNLITASSPSLSPVQLPAQKE 3 VC++S+R+ KA L M IYC GRNL TASS SL PV+LPAQ+E Sbjct: 12 VCMTSLRH-KALLLMNIYCLGRNLTTASSSSLLPVKLPAQRE 52 >XP_007144389.1 hypothetical protein PHAVU_007G152100g [Phaseolus vulgaris] ESW16383.1 hypothetical protein PHAVU_007G152100g [Phaseolus vulgaris] Length = 343 Score = 55.1 bits (131), Expect = 4e-06 Identities = 28/42 (66%), Positives = 34/42 (80%) Frame = -3 Query: 128 VCVSSMRYNKAPLTMKIYCFGRNLITASSPSLSPVQLPAQKE 3 VC++S+R+ KA L M IYC GRNL TASS SL PV+LPAQ+E Sbjct: 12 VCMTSLRH-KALLLMNIYCLGRNLTTASSSSLLPVKLPAQRE 52