BLASTX nr result
ID: Glycyrrhiza31_contig00007224
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00007224 (306 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_008228792.1 PREDICTED: metal transporter Nramp6-like [Prunus ... 62 3e-09 KYP50017.1 Metal transporter Nramp6 [Cajanus cajan] 62 4e-09 XP_010092194.1 Metal transporter Nramp6 [Morus notabilis] EXB504... 62 6e-09 ONI16428.1 hypothetical protein PRUPE_3G097800 [Prunus persica] ... 61 1e-08 XP_004486618.1 PREDICTED: metal transporter Nramp6 isoform X2 [C... 61 1e-08 XP_007217247.1 hypothetical protein PRUPE_ppa003835mg [Prunus pe... 61 1e-08 XP_004486616.1 PREDICTED: metal transporter Nramp6 isoform X1 [C... 61 1e-08 KYP50446.1 Metal transporter Nramp6 [Cajanus cajan] 60 2e-08 XP_007135815.1 hypothetical protein PHAVU_010G160800g [Phaseolus... 60 2e-08 XP_007150803.1 hypothetical protein PHAVU_005G182000g [Phaseolus... 60 3e-08 KRH23638.1 hypothetical protein GLYMA_13G369900 [Glycine max] KR... 59 4e-08 KRH23637.1 hypothetical protein GLYMA_13G369900 [Glycine max] 59 4e-08 KHN31883.1 Metal transporter Nramp6 [Glycine soja] 59 4e-08 XP_003543701.1 PREDICTED: metal transporter Nramp6-like [Glycine... 59 4e-08 XP_009354189.1 PREDICTED: metal transporter Nramp1-like [Pyrus x... 59 5e-08 XP_008354189.1 PREDICTED: metal transporter Nramp6-like [Malus d... 59 5e-08 XP_013465598.1 NRAMP metal ion transporter 6 [Medicago truncatul... 59 5e-08 XP_003546914.1 PREDICTED: metal transporter Nramp6 [Glycine max]... 59 5e-08 XP_013465599.1 NRAMP metal ion transporter 6 [Medicago truncatul... 59 5e-08 OMO52859.1 Natural resistance-associated macrophage protein [Cor... 59 7e-08 >XP_008228792.1 PREDICTED: metal transporter Nramp6-like [Prunus mume] XP_008228793.1 PREDICTED: metal transporter Nramp6-like [Prunus mume] XP_008228794.1 PREDICTED: metal transporter Nramp6-like [Prunus mume] XP_016649107.1 PREDICTED: metal transporter Nramp6-like [Prunus mume] XP_016649108.1 PREDICTED: metal transporter Nramp6-like [Prunus mume] XP_016649109.1 PREDICTED: metal transporter Nramp6-like [Prunus mume] Length = 545 Score = 62.4 bits (150), Expect = 3e-09 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = +2 Query: 161 QPQFISSTGNRSLSNAPLIENTATDQIVVPDVSFW 265 QPQFI+STGNRS SNAPLIENT TDQIVVPD + W Sbjct: 10 QPQFIASTGNRSFSNAPLIENTDTDQIVVPDKTSW 44 >KYP50017.1 Metal transporter Nramp6 [Cajanus cajan] Length = 458 Score = 62.0 bits (149), Expect = 4e-09 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = +2 Query: 161 QPQFISSTGNRSLSNAPLIENTATDQIVVPDVSFW 265 QPQFI+STGNRSLSNAPLIEN+ TDQIVVPD W Sbjct: 10 QPQFIASTGNRSLSNAPLIENSDTDQIVVPDSKSW 44 >XP_010092194.1 Metal transporter Nramp6 [Morus notabilis] EXB50420.1 Metal transporter Nramp6 [Morus notabilis] Length = 509 Score = 61.6 bits (148), Expect = 6e-09 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = +2 Query: 161 QPQFISSTGNRSLSNAPLIENTATDQIVVPDVSFW 265 QPQFI+STGNRSLSNAPLIEN+ TDQIVVPD W Sbjct: 9 QPQFIASTGNRSLSNAPLIENSDTDQIVVPDRKSW 43 >ONI16428.1 hypothetical protein PRUPE_3G097800 [Prunus persica] ONI16429.1 hypothetical protein PRUPE_3G097800 [Prunus persica] ONI16430.1 hypothetical protein PRUPE_3G097800 [Prunus persica] ONI16431.1 hypothetical protein PRUPE_3G097800 [Prunus persica] Length = 501 Score = 60.8 bits (146), Expect = 1e-08 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +2 Query: 161 QPQFISSTGNRSLSNAPLIENTATDQIVVPDVSFW 265 +PQFI+STGNRS SNAPLIENT TDQIVVPD + W Sbjct: 10 RPQFIASTGNRSFSNAPLIENTDTDQIVVPDKTSW 44 >XP_004486618.1 PREDICTED: metal transporter Nramp6 isoform X2 [Cicer arietinum] Length = 508 Score = 60.8 bits (146), Expect = 1e-08 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = +2 Query: 161 QPQFISSTGNRSLSNAPLIENTATDQIVVPDVSFW 265 QPQFISSTGNR+LSNAPLIE + TDQIVVPD S W Sbjct: 18 QPQFISSTGNRNLSNAPLIETSNTDQIVVPDRSSW 52 >XP_007217247.1 hypothetical protein PRUPE_ppa003835mg [Prunus persica] ONI16432.1 hypothetical protein PRUPE_3G097800 [Prunus persica] ONI16433.1 hypothetical protein PRUPE_3G097800 [Prunus persica] ONI16434.1 hypothetical protein PRUPE_3G097800 [Prunus persica] ONI16435.1 hypothetical protein PRUPE_3G097800 [Prunus persica] ONI16436.1 hypothetical protein PRUPE_3G097800 [Prunus persica] Length = 545 Score = 60.8 bits (146), Expect = 1e-08 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +2 Query: 161 QPQFISSTGNRSLSNAPLIENTATDQIVVPDVSFW 265 +PQFI+STGNRS SNAPLIENT TDQIVVPD + W Sbjct: 10 RPQFIASTGNRSFSNAPLIENTDTDQIVVPDKTSW 44 >XP_004486616.1 PREDICTED: metal transporter Nramp6 isoform X1 [Cicer arietinum] XP_004486617.1 PREDICTED: metal transporter Nramp6 isoform X1 [Cicer arietinum] Length = 552 Score = 60.8 bits (146), Expect = 1e-08 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = +2 Query: 161 QPQFISSTGNRSLSNAPLIENTATDQIVVPDVSFW 265 QPQFISSTGNR+LSNAPLIE + TDQIVVPD S W Sbjct: 18 QPQFISSTGNRNLSNAPLIETSNTDQIVVPDRSSW 52 >KYP50446.1 Metal transporter Nramp6 [Cajanus cajan] Length = 544 Score = 60.5 bits (145), Expect = 2e-08 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = +2 Query: 161 QPQFISSTGNRSLSNAPLIENTATDQIVVPDVSFW 265 QPQFISSTGNRSLSNAPLIEN+ T+QIVVPD W Sbjct: 10 QPQFISSTGNRSLSNAPLIENSDTNQIVVPDRRSW 44 >XP_007135815.1 hypothetical protein PHAVU_010G160800g [Phaseolus vulgaris] XP_007135816.1 hypothetical protein PHAVU_010G160800g [Phaseolus vulgaris] XP_007135817.1 hypothetical protein PHAVU_010G160800g [Phaseolus vulgaris] ESW07809.1 hypothetical protein PHAVU_010G160800g [Phaseolus vulgaris] ESW07810.1 hypothetical protein PHAVU_010G160800g [Phaseolus vulgaris] ESW07811.1 hypothetical protein PHAVU_010G160800g [Phaseolus vulgaris] Length = 544 Score = 60.5 bits (145), Expect = 2e-08 Identities = 28/35 (80%), Positives = 32/35 (91%) Frame = +2 Query: 161 QPQFISSTGNRSLSNAPLIENTATDQIVVPDVSFW 265 QPQFI+STGNRSLSNAPLIEN+ +DQIVVPD + W Sbjct: 10 QPQFIASTGNRSLSNAPLIENSDSDQIVVPDRTSW 44 >XP_007150803.1 hypothetical protein PHAVU_005G182000g [Phaseolus vulgaris] XP_007150804.1 hypothetical protein PHAVU_005G182000g [Phaseolus vulgaris] ESW22797.1 hypothetical protein PHAVU_005G182000g [Phaseolus vulgaris] ESW22798.1 hypothetical protein PHAVU_005G182000g [Phaseolus vulgaris] Length = 544 Score = 59.7 bits (143), Expect = 3e-08 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +2 Query: 161 QPQFISSTGNRSLSNAPLIENTATDQIVVPDVSFW 265 QPQFISSTGNRS SNAPLIEN+ T+QIVVPD W Sbjct: 10 QPQFISSTGNRSFSNAPLIENSETNQIVVPDKRSW 44 >KRH23638.1 hypothetical protein GLYMA_13G369900 [Glycine max] KRH23639.1 hypothetical protein GLYMA_13G369900 [Glycine max] Length = 508 Score = 59.3 bits (142), Expect = 4e-08 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +2 Query: 161 QPQFISSTGNRSLSNAPLIENTATDQIVVPDVSFW 265 QPQFISSTGNRS SNAPLIEN+ T+QIVVPD W Sbjct: 10 QPQFISSTGNRSFSNAPLIENSDTNQIVVPDRKSW 44 >KRH23637.1 hypothetical protein GLYMA_13G369900 [Glycine max] Length = 509 Score = 59.3 bits (142), Expect = 4e-08 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +2 Query: 161 QPQFISSTGNRSLSNAPLIENTATDQIVVPDVSFW 265 QPQFISSTGNRS SNAPLIEN+ T+QIVVPD W Sbjct: 10 QPQFISSTGNRSFSNAPLIENSDTNQIVVPDRKSW 44 >KHN31883.1 Metal transporter Nramp6 [Glycine soja] Length = 544 Score = 59.3 bits (142), Expect = 4e-08 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +2 Query: 161 QPQFISSTGNRSLSNAPLIENTATDQIVVPDVSFW 265 QPQFISSTGNRS SNAPLIEN+ T+QIVVPD W Sbjct: 10 QPQFISSTGNRSFSNAPLIENSDTNQIVVPDRKSW 44 >XP_003543701.1 PREDICTED: metal transporter Nramp6-like [Glycine max] XP_014621632.1 PREDICTED: metal transporter Nramp6-like [Glycine max] KRH23640.1 hypothetical protein GLYMA_13G369900 [Glycine max] KRH23641.1 hypothetical protein GLYMA_13G369900 [Glycine max] Length = 544 Score = 59.3 bits (142), Expect = 4e-08 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +2 Query: 161 QPQFISSTGNRSLSNAPLIENTATDQIVVPDVSFW 265 QPQFISSTGNRS SNAPLIEN+ T+QIVVPD W Sbjct: 10 QPQFISSTGNRSFSNAPLIENSDTNQIVVPDRKSW 44 >XP_009354189.1 PREDICTED: metal transporter Nramp1-like [Pyrus x bretschneideri] XP_018502511.1 PREDICTED: metal transporter Nramp1-like [Pyrus x bretschneideri] XP_018502512.1 PREDICTED: metal transporter Nramp1-like [Pyrus x bretschneideri] XP_018502513.1 PREDICTED: metal transporter Nramp1-like [Pyrus x bretschneideri] XP_018502514.1 PREDICTED: metal transporter Nramp1-like [Pyrus x bretschneideri] XP_018502515.1 PREDICTED: metal transporter Nramp1-like [Pyrus x bretschneideri] XP_018502516.1 PREDICTED: metal transporter Nramp1-like [Pyrus x bretschneideri] Length = 545 Score = 58.9 bits (141), Expect = 5e-08 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +2 Query: 161 QPQFISSTGNRSLSNAPLIENTATDQIVVPDVSFW 265 QPQFI+STGNRS SNAPLIE+T T+QIVVPD + W Sbjct: 10 QPQFIASTGNRSFSNAPLIEDTDTEQIVVPDKTSW 44 >XP_008354189.1 PREDICTED: metal transporter Nramp6-like [Malus domestica] XP_008354190.1 PREDICTED: metal transporter Nramp6-like [Malus domestica] XP_017182924.1 PREDICTED: metal transporter Nramp6-like [Malus domestica] XP_017182925.1 PREDICTED: metal transporter Nramp6-like [Malus domestica] Length = 545 Score = 58.9 bits (141), Expect = 5e-08 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +2 Query: 161 QPQFISSTGNRSLSNAPLIENTATDQIVVPDVSFW 265 QPQFI+STGNRS SNAPLIE+T T+QIVVPD + W Sbjct: 10 QPQFIASTGNRSFSNAPLIEDTDTEQIVVPDKTSW 44 >XP_013465598.1 NRAMP metal ion transporter 6 [Medicago truncatula] KEH39634.1 NRAMP metal ion transporter 6 [Medicago truncatula] Length = 545 Score = 58.9 bits (141), Expect = 5e-08 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +2 Query: 161 QPQFISSTGNRSLSNAPLIENTATDQIVVPDVSFW 265 QPQFISSTGNR+ SNAPLI++T TDQIVVPD + W Sbjct: 11 QPQFISSTGNRNFSNAPLIDSTNTDQIVVPDRTSW 45 >XP_003546914.1 PREDICTED: metal transporter Nramp6 [Glycine max] KHN22404.1 Metal transporter Nramp6 [Glycine soja] KRH09654.1 hypothetical protein GLYMA_15G003500 [Glycine max] KRH09655.1 hypothetical protein GLYMA_15G003500 [Glycine max] Length = 546 Score = 58.9 bits (141), Expect = 5e-08 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +2 Query: 161 QPQFISSTGNRSLSNAPLIENTATDQIVVPDVSFW 265 QPQFISSTGNRS SNAPLIEN+ T+QIVVPD W Sbjct: 10 QPQFISSTGNRSFSNAPLIENSDTNQIVVPDRRSW 44 >XP_013465599.1 NRAMP metal ion transporter 6 [Medicago truncatula] KEH39635.1 NRAMP metal ion transporter 6 [Medicago truncatula] Length = 570 Score = 58.9 bits (141), Expect = 5e-08 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +2 Query: 161 QPQFISSTGNRSLSNAPLIENTATDQIVVPDVSFW 265 QPQFISSTGNR+ SNAPLI++T TDQIVVPD + W Sbjct: 36 QPQFISSTGNRNFSNAPLIDSTNTDQIVVPDRTSW 70 >OMO52859.1 Natural resistance-associated macrophage protein [Corchorus capsularis] Length = 523 Score = 58.5 bits (140), Expect = 7e-08 Identities = 27/35 (77%), Positives = 29/35 (82%) Frame = +2 Query: 161 QPQFISSTGNRSLSNAPLIENTATDQIVVPDVSFW 265 QPQFI+STGNRS SNAPLI+N TDQIVVPD W Sbjct: 8 QPQFIASTGNRSFSNAPLIQNADTDQIVVPDRKSW 42