BLASTX nr result
ID: Glycyrrhiza31_contig00007026
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00007026 (609 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012570430.1 PREDICTED: mitochondrial import receptor subunit ... 67 2e-12 XP_013467127.1 translocase of outer membrane complex, subunit TO... 67 3e-12 XP_019450016.1 PREDICTED: mitochondrial import receptor subunit ... 68 1e-11 XP_015967806.1 PREDICTED: mitochondrial import receptor subunit ... 67 2e-11 GAU39639.1 hypothetical protein TSUD_18200 [Trifolium subterraneum] 67 2e-11 XP_019412725.1 PREDICTED: mitochondrial import receptor subunit ... 67 2e-11 XP_016183398.1 PREDICTED: mitochondrial import receptor subunit ... 65 4e-11 XP_019432566.1 PREDICTED: mitochondrial import receptor subunit ... 64 3e-10 XP_015949449.1 PREDICTED: uncharacterized protein LOC107474338 [... 66 4e-10 XP_009370408.1 PREDICTED: mitochondrial import receptor subunit ... 64 4e-10 XP_008358478.1 PREDICTED: mitochondrial import receptor subunit ... 64 4e-10 XP_008372389.1 PREDICTED: mitochondrial import receptor subunit ... 64 4e-10 XP_008235602.1 PREDICTED: mitochondrial import receptor subunit ... 63 1e-09 CAN79350.1 hypothetical protein VITISV_006999 [Vitis vinifera] 62 3e-09 XP_002272982.1 PREDICTED: mitochondrial import receptor subunit ... 62 4e-09 XP_010262447.1 PREDICTED: mitochondrial import receptor subunit ... 62 4e-09 XP_011080111.1 PREDICTED: mitochondrial import receptor subunit ... 61 4e-09 XP_013468435.1 translocase of outer membrane complex, subunit TO... 61 5e-09 XP_007201223.1 hypothetical protein PRUPE_ppa012280mg [Prunus pe... 63 5e-09 XP_009334199.1 PREDICTED: mitochondrial import receptor subunit ... 61 5e-09 >XP_012570430.1 PREDICTED: mitochondrial import receptor subunit TOM9-2-like [Cicer arietinum] Length = 89 Score = 67.4 bits (163), Expect(2) = 2e-12 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = +3 Query: 204 WMVGTSFLILVVPLIVAMDREQQINELESQQASILG 311 W+ GTSFLILVVPLI+AMDREQQINELESQQA+ILG Sbjct: 43 WIAGTSFLILVVPLIIAMDREQQINELESQQANILG 78 Score = 32.7 bits (73), Expect(2) = 2e-12 Identities = 19/25 (76%), Positives = 21/25 (84%) Frame = +2 Query: 101 MAKKPQSVVSRVTESPVVRRTSEAA 175 MAKK SV SRV++SPVVRRT EAA Sbjct: 1 MAKKRISV-SRVSDSPVVRRTKEAA 24 >XP_013467127.1 translocase of outer membrane complex, subunit TOM22 [Medicago truncatula] KEH41163.1 translocase of outer membrane complex, subunit TOM22 [Medicago truncatula] Length = 86 Score = 67.4 bits (163), Expect(2) = 3e-12 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = +3 Query: 204 WMVGTSFLILVVPLIVAMDREQQINELESQQASILG 311 W+ GTSFL+LVVPLIVAMDREQQINELESQQA+ILG Sbjct: 44 WIAGTSFLVLVVPLIVAMDREQQINELESQQANILG 79 Score = 32.0 bits (71), Expect(2) = 3e-12 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +2 Query: 101 MAKKPQSVVSRVTESPVVRRTSEAA 175 MAKK S ++RV PVVR T EAA Sbjct: 1 MAKKQSSAIARVCNHPVVRNTKEAA 25 >XP_019450016.1 PREDICTED: mitochondrial import receptor subunit TOM9-2-like [Lupinus angustifolius] OIW07663.1 hypothetical protein TanjilG_07705 [Lupinus angustifolius] Length = 92 Score = 67.8 bits (164), Expect = 1e-11 Identities = 33/36 (91%), Positives = 35/36 (97%) Frame = +3 Query: 204 WMVGTSFLILVVPLIVAMDREQQINELESQQASILG 311 W+ GT+FLILVVPLIVAMDREQQINELESQQASILG Sbjct: 49 WIAGTTFLILVVPLIVAMDREQQINELESQQASILG 84 >XP_015967806.1 PREDICTED: mitochondrial import receptor subunit TOM9-2-like [Arachis duranensis] Length = 100 Score = 67.0 bits (162), Expect(2) = 2e-11 Identities = 31/36 (86%), Positives = 35/36 (97%) Frame = +3 Query: 204 WMVGTSFLILVVPLIVAMDREQQINELESQQASILG 311 W+ GT+FL+LVVPL+VAMDREQQINELESQQASILG Sbjct: 56 WIAGTTFLVLVVPLVVAMDREQQINELESQQASILG 91 Score = 29.6 bits (65), Expect(2) = 2e-11 Identities = 14/26 (53%), Positives = 18/26 (69%) Frame = +2 Query: 98 TMAKKPQSVVSRVTESPVVRRTSEAA 175 T A V+SRV++SP VRRT +AA Sbjct: 12 TAAGDESGVLSRVSQSPAVRRTKQAA 37 >GAU39639.1 hypothetical protein TSUD_18200 [Trifolium subterraneum] Length = 89 Score = 67.4 bits (163), Expect = 2e-11 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = +3 Query: 204 WMVGTSFLILVVPLIVAMDREQQINELESQQASILG 311 W+ GTSFLILVVPLI+AMDREQQINELESQQA+ILG Sbjct: 43 WIAGTSFLILVVPLIIAMDREQQINELESQQANILG 78 >XP_019412725.1 PREDICTED: mitochondrial import receptor subunit TOM9-2-like [Lupinus angustifolius] OIV98861.1 hypothetical protein TanjilG_21196 [Lupinus angustifolius] Length = 99 Score = 67.4 bits (163), Expect = 2e-11 Identities = 32/36 (88%), Positives = 35/36 (97%) Frame = +3 Query: 204 WMVGTSFLILVVPLIVAMDREQQINELESQQASILG 311 W+ GT+FL+LVVPLIVAMDREQQINELESQQASILG Sbjct: 56 WIAGTTFLVLVVPLIVAMDREQQINELESQQASILG 91 >XP_016183398.1 PREDICTED: mitochondrial import receptor subunit TOM9-2-like [Arachis ipaensis] Length = 100 Score = 65.1 bits (157), Expect(2) = 4e-11 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = +3 Query: 204 WMVGTSFLILVVPLIVAMDREQQINELESQQASILG 311 W+ GT+FL+LVVPL+VAMDREQQINELES QASILG Sbjct: 56 WIAGTTFLVLVVPLVVAMDREQQINELESHQASILG 91 Score = 30.4 bits (67), Expect(2) = 4e-11 Identities = 14/26 (53%), Positives = 19/26 (73%) Frame = +2 Query: 98 TMAKKPQSVVSRVTESPVVRRTSEAA 175 T A + V+SRV++SP VRRT +AA Sbjct: 12 TAAGEESGVLSRVSQSPAVRRTKQAA 37 >XP_019432566.1 PREDICTED: mitochondrial import receptor subunit TOM9-2-like [Lupinus angustifolius] OIW21230.1 hypothetical protein TanjilG_31098 [Lupinus angustifolius] Length = 96 Score = 64.3 bits (155), Expect = 3e-10 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +3 Query: 204 WMVGTSFLILVVPLIVAMDREQQINELESQQASILG 311 W+ GT+FLILVVPLIVAMDREQQI ELESQQASILG Sbjct: 53 WIAGTTFLILVVPLIVAMDREQQIIELESQQASILG 88 >XP_015949449.1 PREDICTED: uncharacterized protein LOC107474338 [Arachis duranensis] Length = 179 Score = 66.2 bits (160), Expect = 4e-10 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +3 Query: 204 WMVGTSFLILVVPLIVAMDREQQINELESQQASILG 311 W+ GT+FLILVVPLIVAMDREQQINE ESQQASILG Sbjct: 135 WIAGTTFLILVVPLIVAMDREQQINEFESQQASILG 170 >XP_009370408.1 PREDICTED: mitochondrial import receptor subunit TOM9-2 [Pyrus x bretschneideri] Length = 102 Score = 64.3 bits (155), Expect = 4e-10 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = +3 Query: 204 WMVGTSFLILVVPLIVAMDREQQINELESQQASILG 311 W+ GTSFLILVVPLI+AMDREQQ+NELE QQA+ILG Sbjct: 61 WIAGTSFLILVVPLIIAMDREQQLNELELQQANILG 96 >XP_008358478.1 PREDICTED: mitochondrial import receptor subunit TOM9-2-like [Malus domestica] XP_008365947.1 PREDICTED: mitochondrial import receptor subunit TOM9-2-like [Malus domestica] Length = 102 Score = 64.3 bits (155), Expect = 4e-10 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = +3 Query: 204 WMVGTSFLILVVPLIVAMDREQQINELESQQASILG 311 W+ GTSFLILVVPLI+AMDREQQ+NELE QQA+ILG Sbjct: 61 WIAGTSFLILVVPLIIAMDREQQLNELELQQANILG 96 >XP_008372389.1 PREDICTED: mitochondrial import receptor subunit TOM9-2 [Malus domestica] Length = 102 Score = 64.3 bits (155), Expect = 4e-10 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = +3 Query: 204 WMVGTSFLILVVPLIVAMDREQQINELESQQASILG 311 W+ GTSFLILVVPLI+AMDREQQ+NELE QQA+ILG Sbjct: 61 WIAGTSFLILVVPLIIAMDREQQLNELELQQANILG 96 >XP_008235602.1 PREDICTED: mitochondrial import receptor subunit TOM9-2 [Prunus mume] ONH93152.1 hypothetical protein PRUPE_8G216100 [Prunus persica] Length = 103 Score = 63.2 bits (152), Expect = 1e-09 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = +3 Query: 204 WMVGTSFLILVVPLIVAMDREQQINELESQQASILG 311 W+ GT+FLILVVPLI+AMDREQQ+NELE QQA+ILG Sbjct: 61 WIAGTTFLILVVPLIIAMDREQQLNELELQQANILG 96 >CAN79350.1 hypothetical protein VITISV_006999 [Vitis vinifera] Length = 95 Score = 61.6 bits (148), Expect = 3e-09 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = +3 Query: 204 WMVGTSFLILVVPLIVAMDREQQINELESQQASILG 311 W+ GT+FLILVVPLI+ MDREQQ+NELE QQAS+LG Sbjct: 55 WIAGTTFLILVVPLIIEMDREQQMNELEMQQASLLG 90 >XP_002272982.1 PREDICTED: mitochondrial import receptor subunit TOM9-2 [Vitis vinifera] CBI37180.3 unnamed protein product, partial [Vitis vinifera] Length = 100 Score = 61.6 bits (148), Expect = 4e-09 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = +3 Query: 204 WMVGTSFLILVVPLIVAMDREQQINELESQQASILG 311 W+ GT+FLILVVPLI+ MDREQQ+NELE QQAS+LG Sbjct: 60 WIAGTTFLILVVPLIIEMDREQQMNELEMQQASLLG 95 >XP_010262447.1 PREDICTED: mitochondrial import receptor subunit TOM9-2-like [Nelumbo nucifera] Length = 101 Score = 61.6 bits (148), Expect = 4e-09 Identities = 28/36 (77%), Positives = 33/36 (91%) Frame = +3 Query: 204 WMVGTSFLILVVPLIVAMDREQQINELESQQASILG 311 W+ GT+FLILVVPLI+ MDREQQ+NELE QQAS+LG Sbjct: 58 WIAGTTFLILVVPLIIEMDREQQMNELEMQQASLLG 93 >XP_011080111.1 PREDICTED: mitochondrial import receptor subunit TOM9-2-like [Sesamum indicum] Length = 92 Score = 61.2 bits (147), Expect = 4e-09 Identities = 27/36 (75%), Positives = 33/36 (91%) Frame = +3 Query: 204 WMVGTSFLILVVPLIVAMDREQQINELESQQASILG 311 W+ GT+FL+LVVPLI+ MDREQQ+NELE QQAS+LG Sbjct: 54 WIAGTTFLVLVVPLIIEMDREQQLNELELQQASLLG 89 >XP_013468435.1 translocase of outer membrane complex, subunit TOM22 [Medicago truncatula] AFK46129.1 unknown [Medicago truncatula] KEH42472.1 translocase of outer membrane complex, subunit TOM22 [Medicago truncatula] Length = 95 Score = 61.2 bits (147), Expect = 5e-09 Identities = 27/36 (75%), Positives = 34/36 (94%) Frame = +3 Query: 204 WMVGTSFLILVVPLIVAMDREQQINELESQQASILG 311 W+VGT+F++LVVPLI+ MDREQQ+N+LE QQASILG Sbjct: 56 WIVGTTFVVLVVPLIIEMDREQQLNDLELQQASILG 91 >XP_007201223.1 hypothetical protein PRUPE_ppa012280mg [Prunus persica] Length = 176 Score = 63.2 bits (152), Expect = 5e-09 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = +3 Query: 204 WMVGTSFLILVVPLIVAMDREQQINELESQQASILG 311 W+ GT+FLILVVPLI+AMDREQQ+NELE QQA+ILG Sbjct: 134 WIAGTTFLILVVPLIIAMDREQQLNELELQQANILG 169 >XP_009334199.1 PREDICTED: mitochondrial import receptor subunit TOM9-2-like [Pyrus x bretschneideri] XP_018498049.1 PREDICTED: mitochondrial import receptor subunit TOM9-2-like [Pyrus x bretschneideri] Length = 100 Score = 61.2 bits (147), Expect = 5e-09 Identities = 29/36 (80%), Positives = 33/36 (91%) Frame = +3 Query: 204 WMVGTSFLILVVPLIVAMDREQQINELESQQASILG 311 W++GT+FLIL VPLI+AMDREQQ NELE QQASILG Sbjct: 56 WILGTTFLILGVPLIIAMDREQQFNELELQQASILG 91