BLASTX nr result
ID: Glycyrrhiza31_contig00006875
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00006875 (484 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004498751.1 PREDICTED: 14 kDa proline-rich protein DC2.15-lik... 59 3e-08 AFK43955.1 unknown [Lotus japonicus] 58 9e-08 KHN33896.1 14 kDa proline-rich protein DC2.15 [Glycine soja] KRH... 57 1e-07 OMO61643.1 hypothetical protein CCACVL1_23348 [Corchorus capsula... 57 1e-07 KYP39942.1 14 kDa proline-rich protein DC2.15 [Cajanus cajan] 57 2e-07 XP_014502564.1 PREDICTED: 14 kDa proline-rich protein DC2.15-lik... 57 2e-07 KHN26905.1 14 kDa proline-rich protein DC2.15 [Glycine soja] 56 3e-07 NP_001235098.1 proline-rich protein precursor [Glycine max] AAF7... 56 3e-07 XP_003588784.2 Lipid transfer protein [Medicago truncatula] AES5... 57 3e-07 GAU23138.1 hypothetical protein TSUD_305860 [Trifolium subterran... 56 4e-07 XP_003588785.1 protease inhibitor/seed storage/LTP family protei... 57 4e-07 XP_007161198.1 hypothetical protein PHAVU_001G050300g [Phaseolus... 56 4e-07 XP_010099842.1 hypothetical protein L484_008499 [Morus notabilis... 56 4e-07 XP_007011824.1 PREDICTED: 14 kDa proline-rich protein DC2.15 [Th... 56 5e-07 ADW80126.1 hybrid proline-rich protein [Gossypium hirsutum] 55 6e-07 XP_012447788.1 PREDICTED: 14 kDa proline-rich protein DC2.15-lik... 55 6e-07 XP_003588779.1 Lipid transfer protein [Medicago truncatula] AES5... 57 6e-07 XP_019416960.1 PREDICTED: 14 kDa proline-rich protein DC2.15-lik... 56 6e-07 XP_003588783.1 Lipid transfer protein [Medicago truncatula] AES5... 56 7e-07 XP_017429097.1 PREDICTED: 14 kDa proline-rich protein DC2.15-lik... 55 9e-07 >XP_004498751.1 PREDICTED: 14 kDa proline-rich protein DC2.15-like [Cicer arietinum] Length = 126 Score = 58.9 bits (141), Expect = 3e-08 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +1 Query: 1 VLGINLNVPVTLSLLLSACQKDVPSGFKCA 90 VLGINLNVP+TLSLLLSACQK +PSGFKC+ Sbjct: 97 VLGINLNVPITLSLLLSACQKSIPSGFKCS 126 >AFK43955.1 unknown [Lotus japonicus] Length = 128 Score = 57.8 bits (138), Expect = 9e-08 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 1 VLGINLNVPVTLSLLLSACQKDVPSGFKCA 90 VLGINLNVPVTLS+LLSACQK VPSGF+CA Sbjct: 99 VLGINLNVPVTLSVLLSACQKTVPSGFQCA 128 >KHN33896.1 14 kDa proline-rich protein DC2.15 [Glycine soja] KRH05188.1 hypothetical protein GLYMA_17G212200 [Glycine max] Length = 126 Score = 57.4 bits (137), Expect = 1e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +1 Query: 1 VLGINLNVPVTLSLLLSACQKDVPSGFKCA 90 VLGINLNVP+TLS+LLSACQK VPSGF+CA Sbjct: 97 VLGINLNVPITLSVLLSACQKTVPSGFQCA 126 >OMO61643.1 hypothetical protein CCACVL1_23348 [Corchorus capsularis] Length = 136 Score = 57.4 bits (137), Expect = 1e-07 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +1 Query: 1 VLGINLNVPVTLSLLLSACQKDVPSGFKC 87 VLGINLN+PVTLSLLLSACQK++P GFKC Sbjct: 107 VLGINLNIPVTLSLLLSACQKEIPPGFKC 135 >KYP39942.1 14 kDa proline-rich protein DC2.15 [Cajanus cajan] Length = 124 Score = 57.0 bits (136), Expect = 2e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +1 Query: 1 VLGINLNVPVTLSLLLSACQKDVPSGFKCA 90 VLGINLNVPVTLSLLLSACQK VP GF+CA Sbjct: 95 VLGINLNVPVTLSLLLSACQKTVPPGFQCA 124 >XP_014502564.1 PREDICTED: 14 kDa proline-rich protein DC2.15-like [Vigna radiata var. radiata] Length = 126 Score = 57.0 bits (136), Expect = 2e-07 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +1 Query: 1 VLGINLNVPVTLSLLLSACQKDVPSGFKCA 90 VLGINLN+P+TLS+LLSACQK VPSGF+CA Sbjct: 97 VLGINLNIPITLSVLLSACQKTVPSGFQCA 126 >KHN26905.1 14 kDa proline-rich protein DC2.15 [Glycine soja] Length = 126 Score = 56.2 bits (134), Expect = 3e-07 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +1 Query: 1 VLGINLNVPVTLSLLLSACQKDVPSGFKCA 90 VLGINLNVP+TLS+LLSACQK VP+GF+CA Sbjct: 97 VLGINLNVPITLSVLLSACQKTVPAGFQCA 126 >NP_001235098.1 proline-rich protein precursor [Glycine max] AAF78903.1 proline-rich protein [Glycine max] ACU13518.1 unknown [Glycine max] KRH15849.1 hypothetical protein GLYMA_14G115500 [Glycine max] Length = 126 Score = 56.2 bits (134), Expect = 3e-07 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +1 Query: 1 VLGINLNVPVTLSLLLSACQKDVPSGFKCA 90 VLGINLNVP+TLS+LLSACQK VP+GF+CA Sbjct: 97 VLGINLNVPITLSVLLSACQKTVPAGFQCA 126 >XP_003588784.2 Lipid transfer protein [Medicago truncatula] AES59035.2 Lipid transfer protein [Medicago truncatula] Length = 164 Score = 57.0 bits (136), Expect = 3e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +1 Query: 1 VLGINLNVPVTLSLLLSACQKDVPSGFKCA 90 VLGINLNVPVTLSLLLSACQK VP+GF+C+ Sbjct: 135 VLGINLNVPVTLSLLLSACQKSVPNGFQCS 164 >GAU23138.1 hypothetical protein TSUD_305860 [Trifolium subterraneum] Length = 132 Score = 56.2 bits (134), Expect = 4e-07 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +1 Query: 1 VLGINLNVPVTLSLLLSACQKDVPSGFKC 87 VLGINLNVP+TLSL+LSACQK VPSGF+C Sbjct: 103 VLGINLNVPITLSLILSACQKTVPSGFQC 131 >XP_003588785.1 protease inhibitor/seed storage/LTP family protein [Medicago truncatula] AES59036.1 protease inhibitor/seed storage/LTP family protein [Medicago truncatula] AFK36514.1 unknown [Medicago truncatula] AFK45094.1 unknown [Medicago truncatula] Length = 151 Score = 56.6 bits (135), Expect = 4e-07 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +1 Query: 1 VLGINLNVPVTLSLLLSACQKDVPSGFKCA 90 VLGINLNVP+TLSLLLSAC+K VPSGF+C+ Sbjct: 122 VLGINLNVPITLSLLLSACEKSVPSGFQCS 151 >XP_007161198.1 hypothetical protein PHAVU_001G050300g [Phaseolus vulgaris] ESW33192.1 hypothetical protein PHAVU_001G050300g [Phaseolus vulgaris] Length = 121 Score = 55.8 bits (133), Expect = 4e-07 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +1 Query: 1 VLGINLNVPVTLSLLLSACQKDVPSGFKC 87 VLGINLNVP+TLS+LLSACQK VPSGF+C Sbjct: 92 VLGINLNVPITLSVLLSACQKTVPSGFQC 120 >XP_010099842.1 hypothetical protein L484_008499 [Morus notabilis] EXB80719.1 hypothetical protein L484_008499 [Morus notabilis] Length = 124 Score = 55.8 bits (133), Expect = 4e-07 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = +1 Query: 1 VLGINLNVPVTLSLLLSACQKDVPSGFKC 87 VLGINLNVP+TLS+L+SACQK VPSGFKC Sbjct: 95 VLGINLNVPLTLSVLISACQKTVPSGFKC 123 >XP_007011824.1 PREDICTED: 14 kDa proline-rich protein DC2.15 [Theobroma cacao] EOY29443.1 Bimodular protein [Theobroma cacao] Length = 133 Score = 55.8 bits (133), Expect = 5e-07 Identities = 24/29 (82%), Positives = 29/29 (100%) Frame = +1 Query: 1 VLGINLNVPVTLSLLLSACQKDVPSGFKC 87 VLGINLN+PV+LSL+LSACQK+VP+GFKC Sbjct: 104 VLGINLNIPVSLSLILSACQKNVPAGFKC 132 >ADW80126.1 hybrid proline-rich protein [Gossypium hirsutum] Length = 122 Score = 55.5 bits (132), Expect = 6e-07 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = +1 Query: 1 VLGINLNVPVTLSLLLSACQKDVPSGFKC 87 VLGINLN+PV+LSL+LSACQK+VP GFKC Sbjct: 93 VLGINLNIPVSLSLILSACQKEVPPGFKC 121 >XP_012447788.1 PREDICTED: 14 kDa proline-rich protein DC2.15-like [Gossypium raimondii] XP_016744657.1 PREDICTED: 14 kDa proline-rich protein DC2.15-like [Gossypium hirsutum] KJB07638.1 hypothetical protein B456_001G034700 [Gossypium raimondii] Length = 126 Score = 55.5 bits (132), Expect = 6e-07 Identities = 24/29 (82%), Positives = 28/29 (96%) Frame = +1 Query: 1 VLGINLNVPVTLSLLLSACQKDVPSGFKC 87 VLGINLN+PV+LSL+LSACQK+VP GFKC Sbjct: 97 VLGINLNIPVSLSLILSACQKEVPPGFKC 125 >XP_003588779.1 Lipid transfer protein [Medicago truncatula] AES59030.1 Lipid transfer protein [Medicago truncatula] Length = 210 Score = 57.0 bits (136), Expect = 6e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = +1 Query: 1 VLGINLNVPVTLSLLLSACQKDVPSGFKCA 90 VLGINLNVPVTLSLLLSACQK VP+GF+C+ Sbjct: 181 VLGINLNVPVTLSLLLSACQKSVPNGFQCS 210 >XP_019416960.1 PREDICTED: 14 kDa proline-rich protein DC2.15-like [Lupinus angustifolius] XP_019416961.1 PREDICTED: 14 kDa proline-rich protein DC2.15-like [Lupinus angustifolius] OIV96477.1 hypothetical protein TanjilG_07869 [Lupinus angustifolius] Length = 164 Score = 56.2 bits (134), Expect = 6e-07 Identities = 25/29 (86%), Positives = 29/29 (100%) Frame = +1 Query: 1 VLGINLNVPVTLSLLLSACQKDVPSGFKC 87 VLGINLNVPVTLSL+LSACQK+VP+GF+C Sbjct: 135 VLGINLNVPVTLSLILSACQKNVPTGFQC 163 >XP_003588783.1 Lipid transfer protein [Medicago truncatula] AES59034.1 Lipid transfer protein [Medicago truncatula] Length = 154 Score = 55.8 bits (133), Expect = 7e-07 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +1 Query: 1 VLGINLNVPVTLSLLLSACQKDVPSGFKCA 90 VLGINLNVPVTLSLLLSAC+K VP+GF+C+ Sbjct: 125 VLGINLNVPVTLSLLLSACEKSVPNGFQCS 154 >XP_017429097.1 PREDICTED: 14 kDa proline-rich protein DC2.15-like [Vigna angularis] KOM48683.1 hypothetical protein LR48_Vigan07g238700 [Vigna angularis] BAT82341.1 hypothetical protein VIGAN_03234300 [Vigna angularis var. angularis] Length = 126 Score = 55.1 bits (131), Expect = 9e-07 Identities = 23/29 (79%), Positives = 29/29 (100%) Frame = +1 Query: 1 VLGINLNVPVTLSLLLSACQKDVPSGFKC 87 +LGINLN+P+TLS+LLSACQK+VPSGF+C Sbjct: 97 LLGINLNIPITLSVLLSACQKNVPSGFQC 125