BLASTX nr result
ID: Glycyrrhiza31_contig00006852
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00006852 (1782 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013452764.1 rhoptry associated membrane antigen, putative [Me... 60 3e-06 XP_013445503.1 hypothetical protein MTR_8g463240 [Medicago trunc... 57 5e-06 >XP_013452764.1 rhoptry associated membrane antigen, putative [Medicago truncatula] KEH26792.1 rhoptry associated membrane antigen, putative [Medicago truncatula] Length = 289 Score = 60.1 bits (144), Expect = 3e-06 Identities = 43/149 (28%), Positives = 74/149 (49%), Gaps = 35/149 (23%) Frame = +2 Query: 17 ENEEIVFGYSTSE-------------------------SEYDEIFVEKEELSNTKPRRKW 121 +NEE++ GY+TSE S YD+IF+EK E +N + Sbjct: 85 DNEEVILGYTTSEESYINEEEAKYCISSDEFDHLEREESNYDQIFIEKGE-TNIDEEEIY 143 Query: 122 ----EEYWNNSERLNKENEVVLGYSISESEHDKIFVEKGEPSNTKSKRKWKEY---WDNS 280 + +N+ +R + + + +S +D+IF+EKGE SN+K KRKWK+Y +DNS Sbjct: 144 CCISSDEYNDLDREESNYDQI--FIEEDSNYDQIFIEKGETSNSKRKRKWKDYCGNFDNS 201 Query: 281 ERLNKINKEVILS---YSTLESEHEFVKK 358 + + + I + Y+T + + + +K Sbjct: 202 RVVYENESDEIRNNKKYATSQKKKGYARK 230 >XP_013445503.1 hypothetical protein MTR_8g463240 [Medicago truncatula] KEH19529.1 hypothetical protein MTR_8g463240 [Medicago truncatula] Length = 139 Score = 56.6 bits (135), Expect = 5e-06 Identities = 26/60 (43%), Positives = 39/60 (65%) Frame = +1 Query: 784 MKILERVSSSLDNFHITTCKEHELRVQFSKERFDDHLQRLIHWNEKKKIKCFYTVDRKYL 963 MKI+ R+ LD+ I + KEHEL+VQFS+E F ++ RL +W ++K CFY D + + Sbjct: 1 MKIVGRIPFFLDDLPIISRKEHELQVQFSEENFQENFNRLKNWTNEEKNNCFYMGDYRVM 60