BLASTX nr result
ID: Glycyrrhiza31_contig00006772
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00006772 (375 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU24954.1 hypothetical protein TSUD_311890 [Trifolium subterran... 85 5e-18 XP_014507742.1 PREDICTED: protein Simiate-like isoform X2 [Vigna... 84 2e-17 KOM33318.1 hypothetical protein LR48_Vigan01g287400 [Vigna angul... 84 2e-17 XP_017425428.1 PREDICTED: protein Simiate-like isoform X2 [Vigna... 84 2e-17 XP_014507740.1 PREDICTED: protein Simiate-like isoform X1 [Vigna... 84 2e-17 XP_004500921.1 PREDICTED: protein Simiate [Cicer arietinum] 83 3e-17 XP_003603812.1 single hybrid motif protein [Medicago truncatula]... 83 3e-17 XP_019438070.1 PREDICTED: protein Simiate [Lupinus angustifolius... 83 3e-17 XP_017435665.1 PREDICTED: protein Simiate [Vigna angularis] KOM5... 82 5e-17 KYP46304.1 UPF0436 protein C9orf6 isogeny [Cajanus cajan] 82 7e-17 XP_007136113.1 hypothetical protein PHAVU_009G018900g [Phaseolus... 82 1e-16 XP_014500623.1 PREDICTED: protein Simiate [Vigna radiata var. ra... 81 2e-16 XP_016167442.1 PREDICTED: FAM206 family protein [Arachis ipaensis] 80 3e-16 XP_015934002.1 PREDICTED: FAM206 family protein [Arachis duranen... 80 3e-16 XP_003527545.1 PREDICTED: FAM206 family protein-like isoform X1 ... 80 4e-16 KRH51670.1 hypothetical protein GLYMA_06G021900 [Glycine max] 80 5e-16 XP_006577762.1 PREDICTED: uncharacterized protein LOC100306155 i... 80 5e-16 XP_002269229.1 PREDICTED: FAM206 family protein isoform X2 [Viti... 77 5e-15 OAY22586.1 hypothetical protein MANES_18G010300 [Manihot esculenta] 76 2e-14 XP_004294133.1 PREDICTED: protein Simiate [Fragaria vesca subsp.... 75 2e-14 >GAU24954.1 hypothetical protein TSUD_311890 [Trifolium subterraneum] Length = 209 Score = 85.1 bits (209), Expect = 5e-18 Identities = 40/44 (90%), Positives = 43/44 (97%) Frame = -2 Query: 374 PELLNVSADREGYIAIMMPKPADWLKVKASLVDLQEYKKVREIS 243 PELLNVSADREGYIAIMMPKPADWLKVKASLV LQEYKK+R++S Sbjct: 153 PELLNVSADREGYIAIMMPKPADWLKVKASLVSLQEYKKMRQVS 196 >XP_014507742.1 PREDICTED: protein Simiate-like isoform X2 [Vigna radiata var. radiata] XP_014507743.1 PREDICTED: protein Simiate-like isoform X2 [Vigna radiata var. radiata] Length = 197 Score = 83.6 bits (205), Expect = 2e-17 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = -2 Query: 374 PELLNVSADREGYIAIMMPKPADWLKVKASLVDLQEYKKVREIS 243 PELLNVSADREGYIAI+MPKPADWLKVKASLV LQEYKK++E+S Sbjct: 154 PELLNVSADREGYIAIIMPKPADWLKVKASLVSLQEYKKLKEVS 197 >KOM33318.1 hypothetical protein LR48_Vigan01g287400 [Vigna angularis] Length = 197 Score = 83.6 bits (205), Expect = 2e-17 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = -2 Query: 374 PELLNVSADREGYIAIMMPKPADWLKVKASLVDLQEYKKVREIS 243 PELLNVSADREGYIAI+MPKPADWLKVKASLV LQEYKK++E+S Sbjct: 154 PELLNVSADREGYIAIIMPKPADWLKVKASLVSLQEYKKLKEVS 197 >XP_017425428.1 PREDICTED: protein Simiate-like isoform X2 [Vigna angularis] Length = 206 Score = 83.6 bits (205), Expect = 2e-17 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = -2 Query: 374 PELLNVSADREGYIAIMMPKPADWLKVKASLVDLQEYKKVREIS 243 PELLNVSADREGYIAI+MPKPADWLKVKASLV LQEYKK++E+S Sbjct: 163 PELLNVSADREGYIAIIMPKPADWLKVKASLVSLQEYKKLKEVS 206 >XP_014507740.1 PREDICTED: protein Simiate-like isoform X1 [Vigna radiata var. radiata] Length = 206 Score = 83.6 bits (205), Expect = 2e-17 Identities = 39/44 (88%), Positives = 43/44 (97%) Frame = -2 Query: 374 PELLNVSADREGYIAIMMPKPADWLKVKASLVDLQEYKKVREIS 243 PELLNVSADREGYIAI+MPKPADWLKVKASLV LQEYKK++E+S Sbjct: 163 PELLNVSADREGYIAIIMPKPADWLKVKASLVSLQEYKKLKEVS 206 >XP_004500921.1 PREDICTED: protein Simiate [Cicer arietinum] Length = 206 Score = 83.2 bits (204), Expect = 3e-17 Identities = 39/44 (88%), Positives = 42/44 (95%) Frame = -2 Query: 374 PELLNVSADREGYIAIMMPKPADWLKVKASLVDLQEYKKVREIS 243 PELLNVSADREGYIAI+MPKP DWLKVKASLV LQEYKK+RE+S Sbjct: 163 PELLNVSADREGYIAIIMPKPGDWLKVKASLVSLQEYKKMREVS 206 >XP_003603812.1 single hybrid motif protein [Medicago truncatula] AES74063.1 single hybrid motif protein [Medicago truncatula] Length = 211 Score = 83.2 bits (204), Expect = 3e-17 Identities = 40/44 (90%), Positives = 41/44 (93%) Frame = -2 Query: 374 PELLNVSADREGYIAIMMPKPADWLKVKASLVDLQEYKKVREIS 243 PELLN SADREGYIAIMMPKPADWLKVKAS V LQEYKKVRE+S Sbjct: 151 PELLNGSADREGYIAIMMPKPADWLKVKASFVSLQEYKKVREVS 194 >XP_019438070.1 PREDICTED: protein Simiate [Lupinus angustifolius] XP_019438071.1 PREDICTED: protein Simiate [Lupinus angustifolius] Length = 195 Score = 82.8 bits (203), Expect = 3e-17 Identities = 39/44 (88%), Positives = 42/44 (95%) Frame = -2 Query: 374 PELLNVSADREGYIAIMMPKPADWLKVKASLVDLQEYKKVREIS 243 PELLNVSA+REGYIAIMMPKPADWLK KASLV LQEYKK+RE+S Sbjct: 152 PELLNVSAEREGYIAIMMPKPADWLKAKASLVSLQEYKKLRELS 195 >XP_017435665.1 PREDICTED: protein Simiate [Vigna angularis] KOM51683.1 hypothetical protein LR48_Vigan09g034200 [Vigna angularis] BAT77662.1 hypothetical protein VIGAN_02025200 [Vigna angularis var. angularis] Length = 206 Score = 82.4 bits (202), Expect = 5e-17 Identities = 38/44 (86%), Positives = 43/44 (97%) Frame = -2 Query: 374 PELLNVSADREGYIAIMMPKPADWLKVKASLVDLQEYKKVREIS 243 PELLNVSADREGYIAI+MPKPADWLKVKASL+ LQEYKK++E+S Sbjct: 163 PELLNVSADREGYIAIIMPKPADWLKVKASLLSLQEYKKLKEVS 206 >KYP46304.1 UPF0436 protein C9orf6 isogeny [Cajanus cajan] Length = 206 Score = 82.0 bits (201), Expect = 7e-17 Identities = 38/44 (86%), Positives = 42/44 (95%) Frame = -2 Query: 374 PELLNVSADREGYIAIMMPKPADWLKVKASLVDLQEYKKVREIS 243 PELLNVSADREGYIAI+MPKP DWLKVKASLV LQEYKK++E+S Sbjct: 163 PELLNVSADREGYIAIIMPKPVDWLKVKASLVSLQEYKKLKEVS 206 >XP_007136113.1 hypothetical protein PHAVU_009G018900g [Phaseolus vulgaris] ESW08107.1 hypothetical protein PHAVU_009G018900g [Phaseolus vulgaris] Length = 206 Score = 81.6 bits (200), Expect = 1e-16 Identities = 37/44 (84%), Positives = 42/44 (95%) Frame = -2 Query: 374 PELLNVSADREGYIAIMMPKPADWLKVKASLVDLQEYKKVREIS 243 PELLNVSADREGYIAI+MPKP DWLK+KASLV LQEYKK++E+S Sbjct: 163 PELLNVSADREGYIAIIMPKPGDWLKIKASLVSLQEYKKLKEVS 206 >XP_014500623.1 PREDICTED: protein Simiate [Vigna radiata var. radiata] Length = 206 Score = 80.9 bits (198), Expect = 2e-16 Identities = 37/44 (84%), Positives = 43/44 (97%) Frame = -2 Query: 374 PELLNVSADREGYIAIMMPKPADWLKVKASLVDLQEYKKVREIS 243 P+LLNVSADREGYIAI+MPKPADWLKVKASL+ LQEYKK++E+S Sbjct: 163 PQLLNVSADREGYIAIIMPKPADWLKVKASLLSLQEYKKLKELS 206 >XP_016167442.1 PREDICTED: FAM206 family protein [Arachis ipaensis] Length = 208 Score = 80.5 bits (197), Expect = 3e-16 Identities = 36/44 (81%), Positives = 42/44 (95%) Frame = -2 Query: 374 PELLNVSADREGYIAIMMPKPADWLKVKASLVDLQEYKKVREIS 243 PELLN SADREGYIAI+MPKPADWLK+KASLV ++EYKK+RE+S Sbjct: 165 PELLNASADREGYIAIIMPKPADWLKIKASLVSVEEYKKLREVS 208 >XP_015934002.1 PREDICTED: FAM206 family protein [Arachis duranensis] Length = 208 Score = 80.5 bits (197), Expect = 3e-16 Identities = 36/44 (81%), Positives = 42/44 (95%) Frame = -2 Query: 374 PELLNVSADREGYIAIMMPKPADWLKVKASLVDLQEYKKVREIS 243 PELLN SADREGYIAI+MPKPADWLK+KASLV ++EYKK+RE+S Sbjct: 165 PELLNASADREGYIAIIMPKPADWLKIKASLVSVEEYKKLREVS 208 >XP_003527545.1 PREDICTED: FAM206 family protein-like isoform X1 [Glycine max] KHN09065.1 Protein FAM206A-like protein [Glycine soja] KRH51671.1 hypothetical protein GLYMA_06G021900 [Glycine max] Length = 203 Score = 80.1 bits (196), Expect = 4e-16 Identities = 38/44 (86%), Positives = 42/44 (95%) Frame = -2 Query: 374 PELLNVSADREGYIAIMMPKPADWLKVKASLVDLQEYKKVREIS 243 PELLNVSA REGYIAI+MPKPADWLKVKASLV LQEYKK+RE++ Sbjct: 160 PELLNVSAYREGYIAIIMPKPADWLKVKASLVSLQEYKKLREVN 203 >KRH51670.1 hypothetical protein GLYMA_06G021900 [Glycine max] Length = 217 Score = 80.1 bits (196), Expect = 5e-16 Identities = 38/44 (86%), Positives = 42/44 (95%) Frame = -2 Query: 374 PELLNVSADREGYIAIMMPKPADWLKVKASLVDLQEYKKVREIS 243 PELLNVSA REGYIAI+MPKPADWLKVKASLV LQEYKK+RE++ Sbjct: 174 PELLNVSAYREGYIAIIMPKPADWLKVKASLVSLQEYKKLREVN 217 >XP_006577762.1 PREDICTED: uncharacterized protein LOC100306155 isoform X1 [Glycine max] KHN45949.1 FAM206 family protein [Glycine soja] KRH61005.1 hypothetical protein GLYMA_04G021700 [Glycine max] Length = 201 Score = 79.7 bits (195), Expect = 5e-16 Identities = 38/44 (86%), Positives = 41/44 (93%) Frame = -2 Query: 374 PELLNVSADREGYIAIMMPKPADWLKVKASLVDLQEYKKVREIS 243 PELLNVSA REGYIAI+MPKPADWLKVKASLV LQEYKK RE++ Sbjct: 158 PELLNVSAGREGYIAIIMPKPADWLKVKASLVSLQEYKKSREVN 201 >XP_002269229.1 PREDICTED: FAM206 family protein isoform X2 [Vitis vinifera] Length = 196 Score = 77.0 bits (188), Expect = 5e-15 Identities = 34/43 (79%), Positives = 41/43 (95%) Frame = -2 Query: 374 PELLNVSADREGYIAIMMPKPADWLKVKASLVDLQEYKKVREI 246 P LLN SADREGYIAI+MPKPADWLKVKASL+D++EYKK++E+ Sbjct: 153 PGLLNSSADREGYIAIIMPKPADWLKVKASLIDIEEYKKLKEV 195 >OAY22586.1 hypothetical protein MANES_18G010300 [Manihot esculenta] Length = 215 Score = 75.9 bits (185), Expect = 2e-14 Identities = 35/42 (83%), Positives = 39/42 (92%) Frame = -2 Query: 374 PELLNVSADREGYIAIMMPKPADWLKVKASLVDLQEYKKVRE 249 PELLN SADREGYIAI+MPKPADWLK KASL+ L+EYKK+RE Sbjct: 172 PELLNSSADREGYIAIIMPKPADWLKAKASLLSLEEYKKMRE 213 >XP_004294133.1 PREDICTED: protein Simiate [Fragaria vesca subsp. vesca] XP_011460784.1 PREDICTED: protein Simiate [Fragaria vesca subsp. vesca] Length = 198 Score = 75.5 bits (184), Expect = 2e-14 Identities = 34/43 (79%), Positives = 40/43 (93%) Frame = -2 Query: 374 PELLNVSADREGYIAIMMPKPADWLKVKASLVDLQEYKKVREI 246 PELLN +ADREGYIAI+MPKPADWLKVK SL+ L+EYKK+RE+ Sbjct: 155 PELLNTAADREGYIAIIMPKPADWLKVKDSLLGLEEYKKLREV 197