BLASTX nr result
ID: Glycyrrhiza31_contig00006247
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00006247 (659 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013449801.1 calcium-transporting ATPase [Medicago truncatula]... 78 4e-13 KHN02549.1 Calcium-transporting ATPase 12, plasma membrane-type ... 78 4e-13 XP_006604467.1 PREDICTED: calcium-transporting ATPase 12, plasma... 78 4e-13 KYP54777.1 Putative calcium-transporting ATPase 12, plasma membr... 78 5e-13 XP_017442930.1 PREDICTED: calcium-transporting ATPase 12, plasma... 75 3e-12 GAU50647.1 hypothetical protein TSUD_333860 [Trifolium subterran... 75 6e-12 XP_014496021.1 PREDICTED: calcium-transporting ATPase 12, plasma... 74 1e-11 KRH67272.1 hypothetical protein GLYMA_03G1577002, partial [Glyci... 71 9e-11 XP_003521262.2 PREDICTED: calcium-transporting ATPase 12, plasma... 71 9e-11 KHN10695.1 Calcium-transporting ATPase 12, plasma membrane-type ... 71 9e-11 XP_004493726.1 PREDICTED: calcium-transporting ATPase 12, plasma... 70 2e-10 XP_014494954.1 PREDICTED: calcium-transporting ATPase 12, plasma... 68 1e-09 XP_017442854.1 PREDICTED: calcium-transporting ATPase 12, plasma... 68 1e-09 KOM25128.1 hypothetical protein LR48_Vigan50s004800 [Vigna angul... 67 3e-09 XP_007162471.1 hypothetical protein PHAVU_001G155200g, partial [... 65 1e-08 XP_009396673.1 PREDICTED: calcium-transporting ATPase 12, plasma... 64 2e-08 OMP04951.1 Cation-transporting P-type ATPase [Corchorus olitorius] 62 1e-07 EOX94624.1 ATPase E1-E2 type family protein / haloacid dehalogen... 61 3e-07 CAN83227.1 hypothetical protein VITISV_029568 [Vitis vinifera] 60 7e-07 CBI26329.3 unnamed protein product, partial [Vitis vinifera] 60 9e-07 >XP_013449801.1 calcium-transporting ATPase [Medicago truncatula] AAL17950.1 type IIB calcium ATPase [Medicago truncatula] KEH23829.1 calcium-transporting ATPase [Medicago truncatula] Length = 1062 Score = 78.2 bits (191), Expect = 4e-13 Identities = 36/49 (73%), Positives = 40/49 (81%) Frame = -3 Query: 657 WEQWGICVGIAAVSWPIAWLVKLIPVSNKLLLGHTKRVKLLAFKIKQAF 511 WEQWGIC+GIA VSWP+A LVKLIPVS+K +TK VKLL FKIK AF Sbjct: 1014 WEQWGICIGIAVVSWPLACLVKLIPVSDKPSFSYTKWVKLLVFKIKNAF 1062 >KHN02549.1 Calcium-transporting ATPase 12, plasma membrane-type [Glycine soja] Length = 1069 Score = 78.2 bits (191), Expect = 4e-13 Identities = 36/54 (66%), Positives = 40/54 (74%), Gaps = 1/54 (1%) Frame = -3 Query: 657 WEQWGICVGIAAVSWPIAWLVKLIPVSNKLLLG-HTKRVKLLAFKIKQAF*FYL 499 WEQWGIC+GIAAVSWPIAW KL+PVS+ H K VK+L FKIK F FYL Sbjct: 1004 WEQWGICIGIAAVSWPIAWFTKLVPVSDITFFSHHVKWVKVLVFKIKHLFSFYL 1057 >XP_006604467.1 PREDICTED: calcium-transporting ATPase 12, plasma membrane-type-like [Glycine max] KRG95593.1 hypothetical protein GLYMA_19G159900 [Glycine max] Length = 1069 Score = 78.2 bits (191), Expect = 4e-13 Identities = 36/54 (66%), Positives = 40/54 (74%), Gaps = 1/54 (1%) Frame = -3 Query: 657 WEQWGICVGIAAVSWPIAWLVKLIPVSNKLLLG-HTKRVKLLAFKIKQAF*FYL 499 WEQWGIC+GIAAVSWPIAW KL+PVS+ H K VK+L FKIK F FYL Sbjct: 1004 WEQWGICIGIAAVSWPIAWFTKLVPVSDITFFSHHVKWVKVLVFKIKHLFSFYL 1057 >KYP54777.1 Putative calcium-transporting ATPase 12, plasma membrane-type [Cajanus cajan] Length = 1060 Score = 77.8 bits (190), Expect = 5e-13 Identities = 34/51 (66%), Positives = 38/51 (74%) Frame = -3 Query: 657 WEQWGICVGIAAVSWPIAWLVKLIPVSNKLLLGHTKRVKLLAFKIKQAF*F 505 WEQWGIC+GIAA+SWPIAW K +PVS+K H K VKLL FKIK F F Sbjct: 1005 WEQWGICIGIAAMSWPIAWFTKRLPVSDKPFASHVKWVKLLVFKIKHIFNF 1055 >XP_017442930.1 PREDICTED: calcium-transporting ATPase 12, plasma membrane-type-like [Vigna angularis] BAT85479.1 hypothetical protein VIGAN_04303500 [Vigna angularis var. angularis] Length = 1050 Score = 75.5 bits (184), Expect = 3e-12 Identities = 34/46 (73%), Positives = 37/46 (80%) Frame = -3 Query: 657 WEQWGICVGIAAVSWPIAWLVKLIPVSNKLLLGHTKRVKLLAFKIK 520 WEQW IC+GIAAVSWPIAW+ KLIPVS+K LL H K VKL KIK Sbjct: 1002 WEQWVICIGIAAVSWPIAWITKLIPVSDKPLLSHVKWVKLSVLKIK 1047 >GAU50647.1 hypothetical protein TSUD_333860 [Trifolium subterraneum] Length = 948 Score = 74.7 bits (182), Expect = 6e-12 Identities = 33/49 (67%), Positives = 40/49 (81%) Frame = -3 Query: 657 WEQWGICVGIAAVSWPIAWLVKLIPVSNKLLLGHTKRVKLLAFKIKQAF 511 WEQWGIC+GIA VSWP+A +VKLIPVS+K +TK +KLL KIK+AF Sbjct: 900 WEQWGICIGIAVVSWPLACIVKLIPVSDKPSFSYTKWIKLLVVKIKKAF 948 >XP_014496021.1 PREDICTED: calcium-transporting ATPase 12, plasma membrane-type-like [Vigna radiata var. radiata] Length = 1050 Score = 73.9 bits (180), Expect = 1e-11 Identities = 32/46 (69%), Positives = 35/46 (76%) Frame = -3 Query: 657 WEQWGICVGIAAVSWPIAWLVKLIPVSNKLLLGHTKRVKLLAFKIK 520 WEQWGIC+GIAAVSWPIAW+ KLIPVS+K H K V L KIK Sbjct: 1002 WEQWGICIGIAAVSWPIAWITKLIPVSDKPFFSHVKWVNLSVLKIK 1047 >KRH67272.1 hypothetical protein GLYMA_03G1577002, partial [Glycine max] Length = 916 Score = 71.2 bits (173), Expect = 9e-11 Identities = 32/50 (64%), Positives = 37/50 (74%), Gaps = 1/50 (2%) Frame = -3 Query: 657 WEQWGICVGIAAVSWPIAWLVKLIPVSNKLLLG-HTKRVKLLAFKIKQAF 511 WEQWGIC+ IAAVSWPIAW+ KL+PVS++ H K VKL FKIK F Sbjct: 867 WEQWGICIVIAAVSWPIAWITKLVPVSDRTFFSHHVKWVKLWVFKIKHLF 916 >XP_003521262.2 PREDICTED: calcium-transporting ATPase 12, plasma membrane-type-like, partial [Glycine max] Length = 920 Score = 71.2 bits (173), Expect = 9e-11 Identities = 32/50 (64%), Positives = 37/50 (74%), Gaps = 1/50 (2%) Frame = -3 Query: 657 WEQWGICVGIAAVSWPIAWLVKLIPVSNKLLLG-HTKRVKLLAFKIKQAF 511 WEQWGIC+ IAAVSWPIAW+ KL+PVS++ H K VKL FKIK F Sbjct: 871 WEQWGICIVIAAVSWPIAWITKLVPVSDRTFFSHHVKWVKLWVFKIKHLF 920 >KHN10695.1 Calcium-transporting ATPase 12, plasma membrane-type [Glycine soja] Length = 945 Score = 71.2 bits (173), Expect = 9e-11 Identities = 32/50 (64%), Positives = 37/50 (74%), Gaps = 1/50 (2%) Frame = -3 Query: 657 WEQWGICVGIAAVSWPIAWLVKLIPVSNKLLLG-HTKRVKLLAFKIKQAF 511 WEQWGIC+ IAAVSWPIAW+ KL+PVS++ H K VKL FKIK F Sbjct: 896 WEQWGICIVIAAVSWPIAWITKLVPVSDRTFFSHHVKWVKLWVFKIKHLF 945 >XP_004493726.1 PREDICTED: calcium-transporting ATPase 12, plasma membrane-type [Cicer arietinum] Length = 1056 Score = 70.1 bits (170), Expect = 2e-10 Identities = 33/50 (66%), Positives = 39/50 (78%), Gaps = 1/50 (2%) Frame = -3 Query: 657 WEQWGICVGIAAVSWPIAWLVKLIPVSNKL-LLGHTKRVKLLAFKIKQAF 511 W+QWGICVGIA VSWP+A L+KLIPVSN +TK KLL FK+K+AF Sbjct: 1007 WDQWGICVGIAIVSWPLACLIKLIPVSNNTPSFTYTKWAKLLVFKLKKAF 1056 >XP_014494954.1 PREDICTED: calcium-transporting ATPase 12, plasma membrane-type [Vigna radiata var. radiata] Length = 1001 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/41 (75%), Positives = 34/41 (82%) Frame = -3 Query: 657 WEQWGICVGIAAVSWPIAWLVKLIPVSNKLLLGHTKRVKLL 535 WEQWGIC+GIAAVSWPIAW+ KLIPVS+K H K VKLL Sbjct: 960 WEQWGICIGIAAVSWPIAWITKLIPVSDK-PFNHVKCVKLL 999 >XP_017442854.1 PREDICTED: calcium-transporting ATPase 12, plasma membrane-type [Vigna angularis] KOM25134.1 hypothetical protein LR48_Vigan50s005400 [Vigna angularis] BAT85483.1 hypothetical protein VIGAN_04303900 [Vigna angularis var. angularis] Length = 1020 Score = 68.2 bits (165), Expect = 1e-09 Identities = 31/41 (75%), Positives = 34/41 (82%) Frame = -3 Query: 657 WEQWGICVGIAAVSWPIAWLVKLIPVSNKLLLGHTKRVKLL 535 WEQWGIC+GIAAVSWPIAW+ KLIPVS+K H K VKLL Sbjct: 979 WEQWGICIGIAAVSWPIAWITKLIPVSDK-PFNHVKCVKLL 1018 >KOM25128.1 hypothetical protein LR48_Vigan50s004800 [Vigna angularis] Length = 1070 Score = 67.0 bits (162), Expect = 3e-09 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = -3 Query: 657 WEQWGICVGIAAVSWPIAWLVKLIPVSNKLLLGHTK 550 WEQW IC+GIAAVSWPIAW+ KLIPVS+K LL H K Sbjct: 1002 WEQWVICIGIAAVSWPIAWITKLIPVSDKPLLSHVK 1037 >XP_007162471.1 hypothetical protein PHAVU_001G155200g, partial [Phaseolus vulgaris] ESW34465.1 hypothetical protein PHAVU_001G155200g, partial [Phaseolus vulgaris] Length = 910 Score = 65.1 bits (157), Expect = 1e-08 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = -3 Query: 657 WEQWGICVGIAAVSWPIAWLVKLIPVSNKLLLGH 556 WEQWGIC+GIAAVSWPIAW+ KL+PVS+K H Sbjct: 869 WEQWGICIGIAAVSWPIAWITKLVPVSDKPFFSH 902 >XP_009396673.1 PREDICTED: calcium-transporting ATPase 12, plasma membrane-type-like [Musa acuminata subsp. malaccensis] Length = 1017 Score = 64.3 bits (155), Expect = 2e-08 Identities = 28/32 (87%), Positives = 28/32 (87%) Frame = -3 Query: 657 WEQWGICVGIAAVSWPIAWLVKLIPVSNKLLL 562 WEQWGICVGIAAVSWPI WLVK IPVSN LL Sbjct: 976 WEQWGICVGIAAVSWPIGWLVKCIPVSNTPLL 1007 >OMP04951.1 Cation-transporting P-type ATPase [Corchorus olitorius] Length = 1067 Score = 62.0 bits (149), Expect = 1e-07 Identities = 27/46 (58%), Positives = 35/46 (76%) Frame = -3 Query: 651 QWGICVGIAAVSWPIAWLVKLIPVSNKLLLGHTKRVKLLAFKIKQA 514 QWG+C+ IAA SWPIAW VKLIPVS+K L + KR +++ +KQA Sbjct: 1004 QWGVCILIAAFSWPIAWFVKLIPVSDKPLFSYLKRSRIIFTIVKQA 1049 >EOX94624.1 ATPase E1-E2 type family protein / haloacid dehalogenase-like hydrolase family protein [Theobroma cacao] Length = 1066 Score = 60.8 bits (146), Expect = 3e-07 Identities = 25/46 (54%), Positives = 34/46 (73%) Frame = -3 Query: 651 QWGICVGIAAVSWPIAWLVKLIPVSNKLLLGHTKRVKLLAFKIKQA 514 QWG+C+ +AA SWPIAW VKLIPVS+K + KR +++ +KQA Sbjct: 1003 QWGVCILLAAFSWPIAWFVKLIPVSDKPFFSYLKRSRIIFTSVKQA 1048 >CAN83227.1 hypothetical protein VITISV_029568 [Vitis vinifera] Length = 565 Score = 59.7 bits (143), Expect = 7e-07 Identities = 24/36 (66%), Positives = 28/36 (77%) Frame = -3 Query: 657 WEQWGICVGIAAVSWPIAWLVKLIPVSNKLLLGHTK 550 W QWG C+GIAAVSWP+ W+VK IPVSNK L + K Sbjct: 529 WGQWGACLGIAAVSWPLGWVVKCIPVSNKPFLSYLK 564 >CBI26329.3 unnamed protein product, partial [Vitis vinifera] Length = 4083 Score = 59.7 bits (143), Expect = 9e-07 Identities = 24/42 (57%), Positives = 31/42 (73%) Frame = -3 Query: 657 WEQWGICVGIAAVSWPIAWLVKLIPVSNKLLLGHTKRVKLLA 532 W QWG C+GIAAVSWP+ W+VK IPVSNK L + + + L + Sbjct: 1431 WGQWGACLGIAAVSWPLGWVVKCIPVSNKPFLSYLRCLSLFS 1472