BLASTX nr result
ID: Glycyrrhiza31_contig00005685
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00005685 (337 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP52842.1 Ethylene-responsive transcription factor RAP2-4 [Caja... 57 2e-07 >KYP52842.1 Ethylene-responsive transcription factor RAP2-4 [Cajanus cajan] Length = 331 Score = 57.4 bits (137), Expect = 2e-07 Identities = 29/38 (76%), Positives = 30/38 (78%), Gaps = 3/38 (7%) Frame = -1 Query: 166 MTHHVFTDELSY---NSQNLKGFGQPTSLLGLNHLTPS 62 MTHHVF D LS N+QNL G GQPTSLLGLNHLTPS Sbjct: 66 MTHHVFADGLSLSFPNTQNLIGLGQPTSLLGLNHLTPS 103