BLASTX nr result
ID: Glycyrrhiza31_contig00005143
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00005143 (357 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU20011.1 hypothetical protein TSUD_273460 [Trifolium subterran... 65 1e-10 KYP68700.1 F-box protein At2g27310 family [Cajanus cajan] 66 2e-10 AFK44578.1 unknown [Medicago truncatula] 61 1e-09 XP_003538103.1 PREDICTED: probable F-box protein At1g60180 [Glyc... 63 3e-09 XP_004506202.1 PREDICTED: F-box protein At2g27310-like [Cicer ar... 63 3e-09 XP_007132466.1 hypothetical protein PHAVU_011G096300g [Phaseolus... 63 4e-09 XP_013455796.1 F-box plant-like protein [Medicago truncatula] KE... 62 5e-09 XP_014493589.1 PREDICTED: F-box protein At2g27310-like [Vigna ra... 62 9e-09 XP_017432712.1 PREDICTED: F-box protein At2g27310-like [Vigna an... 60 2e-08 OIW08477.1 hypothetical protein TanjilG_03153 [Lupinus angustifo... 56 1e-06 XP_019449853.1 PREDICTED: F-box protein At2g27310-like [Lupinus ... 56 1e-06 >GAU20011.1 hypothetical protein TSUD_273460 [Trifolium subterraneum] Length = 198 Score = 65.5 bits (158), Expect = 1e-10 Identities = 34/57 (59%), Positives = 41/57 (71%) Frame = +1 Query: 1 GERKRVNGNANIMKERFEEFTCLTRERRESKHRRQKARDAVSMLLAFLACVLFSFLA 171 GERK+V G MKERFE F L RERRE K RR+K RD V+M++AF+ CV F +LA Sbjct: 141 GERKKV-GEEGEMKERFERFLNLVRERRERKFRRKKERDGVTMVVAFVVCVWFCYLA 196 >KYP68700.1 F-box protein At2g27310 family [Cajanus cajan] Length = 290 Score = 66.2 bits (160), Expect = 2e-10 Identities = 33/59 (55%), Positives = 43/59 (72%) Frame = +1 Query: 1 GERKRVNGNANIMKERFEEFTCLTRERRESKHRRQKARDAVSMLLAFLACVLFSFLAAS 177 GERKR++ + KERFE FTCL +E+RE K +R+KA+D S LLAFLA + F F+A S Sbjct: 232 GERKRIDHVRD--KERFENFTCLMKEKRECKRKREKAKDVASTLLAFLALLFFCFIAGS 288 >AFK44578.1 unknown [Medicago truncatula] Length = 118 Score = 60.8 bits (146), Expect = 1e-09 Identities = 31/57 (54%), Positives = 40/57 (70%) Frame = +1 Query: 1 GERKRVNGNANIMKERFEEFTCLTRERRESKHRRQKARDAVSMLLAFLACVLFSFLA 171 GERK+V+ M+ER+E F L RERRE K +RQK RD VS ++AF+ CV F +LA Sbjct: 61 GERKKVS-EVGEMEERYERFLGLIRERREMKFKRQKVRDGVSTIVAFVVCVWFCYLA 116 >XP_003538103.1 PREDICTED: probable F-box protein At1g60180 [Glycine max] KRH30386.1 hypothetical protein GLYMA_11G181200 [Glycine max] Length = 341 Score = 63.2 bits (152), Expect = 3e-09 Identities = 34/57 (59%), Positives = 42/57 (73%) Frame = +1 Query: 1 GERKRVNGNANIMKERFEEFTCLTRERRESKHRRQKARDAVSMLLAFLACVLFSFLA 171 GERKRV+ + K+RF +FTCL +ERRE K RR+KARD VS LA +A +LF FLA Sbjct: 285 GERKRVDHVRD--KDRFMKFTCLMKERRERKFRREKARDLVSTFLALVALLLFCFLA 339 >XP_004506202.1 PREDICTED: F-box protein At2g27310-like [Cicer arietinum] Length = 346 Score = 63.2 bits (152), Expect = 3e-09 Identities = 31/57 (54%), Positives = 42/57 (73%) Frame = +1 Query: 1 GERKRVNGNANIMKERFEEFTCLTRERRESKHRRQKARDAVSMLLAFLACVLFSFLA 171 GERK+V+ MKERFE F + +ERRE KHRR++ARDAVS+++ F+ VLF +A Sbjct: 289 GERKKVD-EVGEMKERFERFMSMIKERRERKHRRERARDAVSLIVVFIVFVLFCCIA 344 >XP_007132466.1 hypothetical protein PHAVU_011G096300g [Phaseolus vulgaris] ESW04460.1 hypothetical protein PHAVU_011G096300g [Phaseolus vulgaris] Length = 331 Score = 62.8 bits (151), Expect = 4e-09 Identities = 33/57 (57%), Positives = 42/57 (73%) Frame = +1 Query: 1 GERKRVNGNANIMKERFEEFTCLTRERRESKHRRQKARDAVSMLLAFLACVLFSFLA 171 G RKRV+ + KERF++FTCL +ERRE K RR++ARD +S L AFLA + F FLA Sbjct: 275 GVRKRVDNVRD--KERFQKFTCLMKERRERKFRREEARDLLSTLFAFLAFLFFCFLA 329 >XP_013455796.1 F-box plant-like protein [Medicago truncatula] KEH29827.1 F-box plant-like protein [Medicago truncatula] Length = 344 Score = 62.4 bits (150), Expect = 5e-09 Identities = 32/57 (56%), Positives = 40/57 (70%) Frame = +1 Query: 1 GERKRVNGNANIMKERFEEFTCLTRERRESKHRRQKARDAVSMLLAFLACVLFSFLA 171 GERK+V+ MKER+E F L RERRE K +RQK RD VS ++AF+ CV F +LA Sbjct: 287 GERKKVS-EVGEMKERYERFLGLIRERREMKFKRQKVRDGVSTIVAFVVCVWFCYLA 342 >XP_014493589.1 PREDICTED: F-box protein At2g27310-like [Vigna radiata var. radiata] Length = 331 Score = 61.6 bits (148), Expect = 9e-09 Identities = 32/57 (56%), Positives = 40/57 (70%) Frame = +1 Query: 1 GERKRVNGNANIMKERFEEFTCLTRERRESKHRRQKARDAVSMLLAFLACVLFSFLA 171 G RKR++ KERF++FTCL +E RE K R +KARD +S L AFLAC+ F FLA Sbjct: 275 GVRKRLDDVRE--KERFQKFTCLMKESRERKFRMEKARDFLSTLFAFLACLFFCFLA 329 >XP_017432712.1 PREDICTED: F-box protein At2g27310-like [Vigna angularis] BAT90377.1 hypothetical protein VIGAN_06161200 [Vigna angularis var. angularis] Length = 331 Score = 60.5 bits (145), Expect = 2e-08 Identities = 32/57 (56%), Positives = 39/57 (68%) Frame = +1 Query: 1 GERKRVNGNANIMKERFEEFTCLTRERRESKHRRQKARDAVSMLLAFLACVLFSFLA 171 G RKRV+ KERF++FTCL +E RE K R +KARD +S L A LAC+ F FLA Sbjct: 275 GVRKRVDAVRE--KERFQKFTCLMKESRERKFRWEKARDLLSTLFALLACLFFCFLA 329 >OIW08477.1 hypothetical protein TanjilG_03153 [Lupinus angustifolius] Length = 341 Score = 55.8 bits (133), Expect = 1e-06 Identities = 30/57 (52%), Positives = 40/57 (70%) Frame = +1 Query: 1 GERKRVNGNANIMKERFEEFTCLTRERRESKHRRQKARDAVSMLLAFLACVLFSFLA 171 GERK+V+ + ERF +F+ + +ERRE KHRR+KA V MLL F+A VLF F+A Sbjct: 285 GERKKVDEVRAM--ERFVKFSRVIKERREMKHRREKAHGVVCMLLVFIALVLFCFIA 339 >XP_019449853.1 PREDICTED: F-box protein At2g27310-like [Lupinus angustifolius] Length = 377 Score = 55.8 bits (133), Expect = 1e-06 Identities = 30/57 (52%), Positives = 40/57 (70%) Frame = +1 Query: 1 GERKRVNGNANIMKERFEEFTCLTRERRESKHRRQKARDAVSMLLAFLACVLFSFLA 171 GERK+V+ + ERF +F+ + +ERRE KHRR+KA V MLL F+A VLF F+A Sbjct: 321 GERKKVDEVRAM--ERFVKFSRVIKERREMKHRREKAHGVVCMLLVFIALVLFCFIA 375