BLASTX nr result
ID: Glycyrrhiza31_contig00005051
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00005051 (341 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ACU16035.1 unknown [Glycine max] KRH46521.1 hypothetical protein... 51 2e-06 >ACU16035.1 unknown [Glycine max] KRH46521.1 hypothetical protein GLYMA_08G339500 [Glycine max] Length = 58 Score = 51.2 bits (121), Expect = 2e-06 Identities = 26/54 (48%), Positives = 34/54 (62%), Gaps = 1/54 (1%) Frame = +1 Query: 43 IIAFLPFASFIFLPSTTFAARVM-KTPVTSCALDPHRSCAPPRKPSCNPYIRNC 201 I+ FL AS FLPS+T A +++ K VT C +P+ C PP K +C YIRNC Sbjct: 5 IVFFLLLASVFFLPSSTLARQLLQKGGVTGCTSNPNIPCYPPPKRACPIYIRNC 58