BLASTX nr result
ID: Glycyrrhiza31_contig00003851
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00003851 (849 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_008467004.1 PREDICTED: LOW QUALITY PROTEIN: cytochrome b6, pa... 67 2e-09 XP_013455724.1 photosystem II reaction center protein H [Medicag... 58 2e-07 CDP57007.1 Cytochrome b6-f complex subunit, cytochrome b6 [Staph... 59 2e-06 AFK38511.1 unknown [Medicago truncatula] 57 3e-06 YP_009327919.1 cytochrome b6 (chloroplast) [Medicago falcata] AO... 57 4e-06 >XP_008467004.1 PREDICTED: LOW QUALITY PROTEIN: cytochrome b6, partial [Cucumis melo] Length = 260 Score = 67.0 bits (162), Expect = 2e-09 Identities = 35/46 (76%), Positives = 37/46 (80%), Gaps = 1/46 (2%) Frame = +2 Query: 713 LLHISVFPITSI*VFLFEPYEMKFSYTVLR-GVLWFTYLNKVYDWF 847 L+HISV + I VFLFEPYE KFSYTVLR G WFTYLNKVYDWF Sbjct: 10 LVHISV--TSGIWVFLFEPYETKFSYTVLRGGSPWFTYLNKVYDWF 53 >XP_013455724.1 photosystem II reaction center protein H [Medicago truncatula] KEH29755.1 photosystem II reaction center protein H [Medicago truncatula] Length = 92 Score = 57.8 bits (138), Expect = 2e-07 Identities = 28/42 (66%), Positives = 33/42 (78%), Gaps = 3/42 (7%) Frame = +2 Query: 29 LLELILLIVQNIKWIRHL---DRDGFTPSDIYSSIWSTEYRK 145 L+ + + + NIK IRHL DRDGFTPSDIYS+IWSTEYRK Sbjct: 42 LMGIAMALFANIKRIRHLSYLDRDGFTPSDIYSNIWSTEYRK 83 >CDP57007.1 Cytochrome b6-f complex subunit, cytochrome b6 [Staphylococcus aureus subsp. aureus] Length = 267 Score = 58.9 bits (141), Expect = 2e-06 Identities = 32/56 (57%), Positives = 37/56 (66%), Gaps = 1/56 (1%) Frame = +2 Query: 683 IGLS*EV*NFLLHISVFPITSI*VFLFEPYEMKFSYTVLRG-VLWFTYLNKVYDWF 847 I L+ ++ F S+ + VFLFE YEMKFSYTVL G WFTYLNKVYDWF Sbjct: 5 IKLNEKIKKFQTFYSISVSANTWVFLFELYEMKFSYTVLGGGSSWFTYLNKVYDWF 60 >AFK38511.1 unknown [Medicago truncatula] Length = 223 Score = 57.4 bits (137), Expect = 3e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +2 Query: 776 MKFSYTVLRGVLWFTYLNKVYDWF 847 MKFSYTVLRGVLWFTYLNKVYDWF Sbjct: 1 MKFSYTVLRGVLWFTYLNKVYDWF 24 >YP_009327919.1 cytochrome b6 (chloroplast) [Medicago falcata] AOG66176.1 cytochrome b6 (chloroplast) [Medicago sativa] APC60463.1 cytochrome b6 (chloroplast) [Medicago falcata] Length = 231 Score = 57.4 bits (137), Expect = 4e-06 Identities = 24/24 (100%), Positives = 24/24 (100%) Frame = +2 Query: 776 MKFSYTVLRGVLWFTYLNKVYDWF 847 MKFSYTVLRGVLWFTYLNKVYDWF Sbjct: 1 MKFSYTVLRGVLWFTYLNKVYDWF 24