BLASTX nr result
ID: Glycyrrhiza31_contig00003179
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00003179 (438 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ABN49455.1 photosystem I chlorophyll a/b binding protein, partia... 106 9e-27 ALX37541.1 chlorophyll a /b binding protein, partial [Beta nana] 105 4e-26 ALX37542.1 chlorophyll a /b binding protein, partial [Beta macro... 105 5e-26 ALX37543.1 chlorophyll a /b binding protein, partial [Beta lomat... 105 5e-26 ALX37556.1 chlorophyll a /b binding protein, partial [Beta vulga... 105 6e-26 ALX37547.1 chlorophyll a /b binding protein, partial [Beta vulga... 105 6e-26 ALX37544.1 chlorophyll a /b binding protein, partial [Beta vulga... 105 6e-26 ABX71549.1 chloroplast chlorophyll a/b binding protein, partial ... 103 8e-26 Q9SQL2.1 RecName: Full=Chlorophyll a-b binding protein P4, chlor... 106 1e-25 4Y28_4 Chain 4, The Structure Of Plant Photosystem I Super-compl... 106 1e-25 XP_004138171.1 PREDICTED: chlorophyll a-b binding protein P4, ch... 105 4e-25 XP_019437147.1 PREDICTED: chlorophyll a-b binding protein P4, ch... 105 5e-25 XP_010678492.1 PREDICTED: chlorophyll a-b binding protein 4, chl... 105 5e-25 AAP69815.1 chlorophyll a/b-binding protein, partial [Vitis vinif... 100 6e-25 XP_013459283.1 light-harvesting complex I chlorophyll A/B-bindin... 103 7e-25 XP_008453211.1 PREDICTED: chlorophyll a-b binding protein P4, ch... 104 7e-25 KVI06427.1 Chlorophyll A-B binding protein [Cynara cardunculus v... 104 9e-25 AEX12937.1 hypothetical protein CL1595Contig1_02, partial [Pinus... 99 9e-25 XP_006374459.1 hypothetical protein POPTR_0015s07340g [Populus t... 101 1e-24 OAY31051.1 hypothetical protein MANES_14G079800 [Manihot esculenta] 104 1e-24 >ABN49455.1 photosystem I chlorophyll a/b binding protein, partial (chloroplast) [Pisum sativum] Length = 144 Score = 106 bits (265), Expect = 9e-27 Identities = 48/50 (96%), Positives = 50/50 (100%) Frame = -1 Query: 438 KEIANGRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLGGN 289 KEIANGRLAMLAFLGFI+QHNVTGKGPFDNLLQH+SDPWHNTIVQTLGGN Sbjct: 95 KEIANGRLAMLAFLGFIIQHNVTGKGPFDNLLQHISDPWHNTIVQTLGGN 144 >ALX37541.1 chlorophyll a /b binding protein, partial [Beta nana] Length = 148 Score = 105 bits (261), Expect = 4e-26 Identities = 47/50 (94%), Positives = 49/50 (98%) Frame = -1 Query: 438 KEIANGRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLGGN 289 KE+ANGRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTI+QT GGN Sbjct: 99 KELANGRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIIQTFGGN 148 >ALX37542.1 chlorophyll a /b binding protein, partial [Beta macrorhiza] Length = 158 Score = 105 bits (261), Expect = 5e-26 Identities = 47/50 (94%), Positives = 49/50 (98%) Frame = -1 Query: 438 KEIANGRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLGGN 289 KE+ANGRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTI+QT GGN Sbjct: 109 KELANGRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIIQTFGGN 158 >ALX37543.1 chlorophyll a /b binding protein, partial [Beta lomatogona] Length = 159 Score = 105 bits (261), Expect = 5e-26 Identities = 47/50 (94%), Positives = 49/50 (98%) Frame = -1 Query: 438 KEIANGRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLGGN 289 KE+ANGRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTI+QT GGN Sbjct: 110 KELANGRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIIQTFGGN 159 >ALX37556.1 chlorophyll a /b binding protein, partial [Beta vulgaris subsp. maritima] ALX37558.1 chlorophyll a /b binding protein, partial [Beta vulgaris subsp. maritima] ALX37594.1 chlorophyll a /b binding protein, partial [Beta macrocarpa] ALX37595.1 chlorophyll a /b binding protein, partial [Beta macrocarpa] Length = 163 Score = 105 bits (261), Expect = 6e-26 Identities = 47/50 (94%), Positives = 49/50 (98%) Frame = -1 Query: 438 KEIANGRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLGGN 289 KE+ANGRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTI+QT GGN Sbjct: 114 KELANGRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIIQTFGGN 163 >ALX37547.1 chlorophyll a /b binding protein, partial [Beta vulgaris subsp. maritima] Length = 163 Score = 105 bits (261), Expect = 6e-26 Identities = 47/50 (94%), Positives = 49/50 (98%) Frame = -1 Query: 438 KEIANGRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLGGN 289 KE+ANGRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTI+QT GGN Sbjct: 114 KELANGRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIIQTFGGN 163 >ALX37544.1 chlorophyll a /b binding protein, partial [Beta vulgaris subsp. maritima] ALX37545.1 chlorophyll a /b binding protein, partial [Beta vulgaris subsp. maritima] ALX37546.1 chlorophyll a /b binding protein, partial [Beta vulgaris subsp. maritima] ALX37548.1 chlorophyll a /b binding protein, partial [Beta vulgaris subsp. maritima] ALX37549.1 chlorophyll a /b binding protein, partial [Beta vulgaris subsp. maritima] ALX37550.1 chlorophyll a /b binding protein, partial [Beta vulgaris subsp. maritima] ALX37551.1 chlorophyll a /b binding protein, partial [Beta vulgaris subsp. maritima] ALX37552.1 chlorophyll a /b binding protein, partial [Beta vulgaris subsp. maritima] ALX37553.1 chlorophyll a /b binding protein, partial [Beta vulgaris subsp. maritima] ALX37554.1 chlorophyll a /b binding protein, partial [Beta vulgaris subsp. maritima] ALX37555.1 chlorophyll a /b binding protein, partial [Beta vulgaris subsp. maritima] ALX37557.1 chlorophyll a /b binding protein, partial [Beta vulgaris subsp. maritima] ALX37559.1 chlorophyll a /b binding protein, partial [Beta vulgaris subsp. maritima] ALX37560.1 chlorophyll a /b binding protein, partial [Beta vulgaris subsp. maritima] ALX37561.1 chlorophyll a /b binding protein, partial [Beta vulgaris subsp. maritima] ALX37562.1 chlorophyll a /b binding protein, partial [Beta vulgaris subsp. maritima] ALX37563.1 chlorophyll a /b binding protein, partial [Beta vulgaris subsp. maritima] ALX37564.1 chlorophyll a /b binding protein, partial [Beta vulgaris subsp. maritima] ALX37565.1 chlorophyll a /b binding protein, partial [Beta vulgaris subsp. maritima] ALX37566.1 chlorophyll a /b binding protein, partial [Beta vulgaris subsp. maritima] ALX37567.1 chlorophyll a /b binding protein, partial [Beta vulgaris subsp. maritima] ALX37568.1 chlorophyll a /b binding protein, partial [Beta vulgaris subsp. maritima] ALX37569.1 chlorophyll a /b binding protein, partial [Beta vulgaris subsp. maritima] ALX37570.1 chlorophyll a /b binding protein, partial [Beta vulgaris subsp. maritima] ALX37571.1 chlorophyll a /b binding protein, partial [Beta vulgaris subsp. maritima] ALX37572.1 chlorophyll a /b binding protein, partial [Beta vulgaris subsp. maritima] ALX37573.1 chlorophyll a /b binding protein, partial [Beta vulgaris subsp. maritima] ALX37574.1 chlorophyll a /b binding protein, partial [Beta vulgaris subsp. maritima] ALX37575.1 chlorophyll a /b binding protein, partial [Beta vulgaris subsp. maritima] ALX37576.1 chlorophyll a /b binding protein, partial [Beta vulgaris subsp. adanensis] ALX37577.1 chlorophyll a /b binding protein, partial [Beta vulgaris subsp. adanensis] ALX37578.1 chlorophyll a /b binding protein, partial [Beta vulgaris subsp. adanensis] ALX37579.1 chlorophyll a /b binding protein, partial [Beta vulgaris subsp. adanensis] ALX37580.1 chlorophyll a /b binding protein, partial [Beta vulgaris subsp. adanensis] ALX37581.1 chlorophyll a /b binding protein, partial [Beta vulgaris subsp. adanensis] ALX37582.1 chlorophyll a /b binding protein, partial [Beta vulgaris subsp. adanensis] ALX37583.1 chlorophyll a /b binding protein, partial [Beta vulgaris subsp. adanensis] ALX37584.1 chlorophyll a /b binding protein, partial [Beta vulgaris subsp. adanensis] ALX37585.1 chlorophyll a /b binding protein, partial [Beta vulgaris subsp. adanensis] ALX37586.1 chlorophyll a /b binding protein, partial [Beta vulgaris subsp. adanensis] ALX37587.1 chlorophyll a /b binding protein, partial [Beta macrocarpa] ALX37588.1 chlorophyll a /b binding protein, partial [Beta macrocarpa] ALX37589.1 chlorophyll a /b binding protein, partial [Beta macrocarpa] ALX37590.1 chlorophyll a /b binding protein, partial [Beta macrocarpa] ALX37591.1 chlorophyll a /b binding protein, partial [Beta macrocarpa] ALX37592.1 chlorophyll a /b binding protein, partial [Beta macrocarpa] ALX37593.1 chlorophyll a /b binding protein, partial [Beta macrocarpa] ALX37596.1 chlorophyll a /b binding protein, partial [Beta macrocarpa] ALX37597.1 chlorophyll a /b binding protein, partial [Beta macrocarpa] Length = 163 Score = 105 bits (261), Expect = 6e-26 Identities = 47/50 (94%), Positives = 49/50 (98%) Frame = -1 Query: 438 KEIANGRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLGGN 289 KE+ANGRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTI+QT GGN Sbjct: 114 KELANGRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIIQTFGGN 163 >ABX71549.1 chloroplast chlorophyll a/b binding protein, partial [Helianthus annuus] ABX71550.1 chloroplast chlorophyll a/b binding protein, partial [Helianthus annuus] ABX71551.1 chloroplast chlorophyll a/b binding protein, partial [Helianthus annuus] ABX71552.1 chloroplast chlorophyll a/b binding protein, partial [Helianthus annuus] ABX71553.1 chloroplast chlorophyll a/b binding protein, partial [Helianthus annuus] ABX71554.1 chloroplast chlorophyll a/b binding protein, partial [Helianthus annuus] ABX71555.1 chloroplast chlorophyll a/b binding protein, partial [Helianthus annuus] ABX71556.1 chloroplast chlorophyll a/b binding protein, partial [Helianthus annuus] ABX71557.1 chloroplast chlorophyll a/b binding protein, partial [Helianthus annuus] ABX71558.1 chloroplast chlorophyll a/b binding protein, partial [Helianthus annuus] ABX71559.1 chloroplast chlorophyll a/b binding protein, partial [Helianthus annuus] ABX71560.1 chloroplast chlorophyll a/b binding protein, partial [Helianthus annuus] ABX71561.1 chloroplast chlorophyll a/b binding protein, partial [Helianthus annuus] ABX71562.1 chloroplast chlorophyll a/b binding protein, partial [Helianthus annuus] ABX71563.1 chloroplast chlorophyll a/b binding protein, partial [Helianthus annuus] ABX71564.1 chloroplast chlorophyll a/b binding protein, partial [Helianthus annuus] ABX71565.1 chloroplast chlorophyll a/b binding protein, partial [Helianthus annuus] ABX71566.1 chloroplast chlorophyll a/b binding protein, partial [Helianthus annuus] ABX71567.1 chloroplast chlorophyll a/b binding protein, partial [Helianthus annuus] Length = 135 Score = 103 bits (258), Expect = 8e-26 Identities = 47/50 (94%), Positives = 49/50 (98%) Frame = -1 Query: 438 KEIANGRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLGGN 289 KE+ANGRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQT+ GN Sbjct: 86 KELANGRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTMSGN 135 >Q9SQL2.1 RecName: Full=Chlorophyll a-b binding protein P4, chloroplastic; AltName: Full=LHCI type III CAB-P4; Flags: Precursor AAF13731.1 PSI light-harvesting antenna chlorophyll a/b-binding protein [Pisum sativum] Length = 252 Score = 106 bits (265), Expect = 1e-25 Identities = 48/50 (96%), Positives = 50/50 (100%) Frame = -1 Query: 438 KEIANGRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLGGN 289 KEIANGRLAMLAFLGFI+QHNVTGKGPFDNLLQH+SDPWHNTIVQTLGGN Sbjct: 203 KEIANGRLAMLAFLGFIIQHNVTGKGPFDNLLQHISDPWHNTIVQTLGGN 252 >4Y28_4 Chain 4, The Structure Of Plant Photosystem I Super-complex At 2.8 Angstrom Resolution. Length = 252 Score = 106 bits (265), Expect = 1e-25 Identities = 48/50 (96%), Positives = 50/50 (100%) Frame = -1 Query: 438 KEIANGRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLGGN 289 KEIANGRLAMLAFLGFI+QHNVTGKGPFDNLLQH+SDPWHNTIVQTLGGN Sbjct: 203 KEIANGRLAMLAFLGFIIQHNVTGKGPFDNLLQHISDPWHNTIVQTLGGN 252 >XP_004138171.1 PREDICTED: chlorophyll a-b binding protein P4, chloroplastic [Cucumis sativus] KGN63677.1 hypothetical protein Csa_1G009810 [Cucumis sativus] Length = 252 Score = 105 bits (262), Expect = 4e-25 Identities = 48/50 (96%), Positives = 49/50 (98%) Frame = -1 Query: 438 KEIANGRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLGGN 289 KEIANGRLAMLAFLGFIVQHNVTGKGPFDNLLQH+SDPWHNTIVQT GGN Sbjct: 203 KEIANGRLAMLAFLGFIVQHNVTGKGPFDNLLQHISDPWHNTIVQTFGGN 252 >XP_019437147.1 PREDICTED: chlorophyll a-b binding protein P4, chloroplastic-like [Lupinus angustifolius] OIW15420.1 hypothetical protein TanjilG_32659 [Lupinus angustifolius] Length = 251 Score = 105 bits (261), Expect = 5e-25 Identities = 48/50 (96%), Positives = 49/50 (98%) Frame = -1 Query: 438 KEIANGRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLGGN 289 KEIANGRLAMLAFLGFI+QHNVTGKGPFDNLLQHLS PWHNTIVQTLGGN Sbjct: 202 KEIANGRLAMLAFLGFIIQHNVTGKGPFDNLLQHLSSPWHNTIVQTLGGN 251 >XP_010678492.1 PREDICTED: chlorophyll a-b binding protein 4, chloroplastic [Beta vulgaris subsp. vulgaris] CAE30280.1 chlorophyll a /b binding protein [Beta vulgaris] KMT10798.1 hypothetical protein BVRB_5g114540 [Beta vulgaris subsp. vulgaris] Length = 252 Score = 105 bits (261), Expect = 5e-25 Identities = 47/50 (94%), Positives = 49/50 (98%) Frame = -1 Query: 438 KEIANGRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLGGN 289 KE+ANGRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTI+QT GGN Sbjct: 203 KELANGRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIIQTFGGN 252 >AAP69815.1 chlorophyll a/b-binding protein, partial [Vitis vinifera] Length = 96 Score = 100 bits (249), Expect = 6e-25 Identities = 45/49 (91%), Positives = 48/49 (97%) Frame = -1 Query: 438 KEIANGRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLGG 292 KE+ANGRLAMLAFLGFIVQHNVTGKGPFDNLLQH+SDPWHNTI+QTL G Sbjct: 47 KELANGRLAMLAFLGFIVQHNVTGKGPFDNLLQHISDPWHNTIIQTLRG 95 >XP_013459283.1 light-harvesting complex I chlorophyll A/B-binding protein [Medicago truncatula] KEH33314.1 light-harvesting complex I chlorophyll A/B-binding protein [Medicago truncatula] Length = 192 Score = 103 bits (256), Expect = 7e-25 Identities = 47/50 (94%), Positives = 49/50 (98%) Frame = -1 Query: 438 KEIANGRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLGGN 289 KEIANGRLAMLAFLGFI+QHNVTGKGPFDNLLQHLSDPWHNTIVQTL G+ Sbjct: 142 KEIANGRLAMLAFLGFIIQHNVTGKGPFDNLLQHLSDPWHNTIVQTLSGS 191 >XP_008453211.1 PREDICTED: chlorophyll a-b binding protein P4, chloroplastic [Cucumis melo] Length = 252 Score = 104 bits (260), Expect = 7e-25 Identities = 47/50 (94%), Positives = 49/50 (98%) Frame = -1 Query: 438 KEIANGRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLGGN 289 KE+ANGRLAMLAFLGFIVQHNVTGKGPFDNLLQH+SDPWHNTIVQT GGN Sbjct: 203 KELANGRLAMLAFLGFIVQHNVTGKGPFDNLLQHISDPWHNTIVQTFGGN 252 >KVI06427.1 Chlorophyll A-B binding protein [Cynara cardunculus var. scolymus] Length = 246 Score = 104 bits (259), Expect = 9e-25 Identities = 48/50 (96%), Positives = 49/50 (98%) Frame = -1 Query: 438 KEIANGRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLGGN 289 KEIANGRLAMLAFLGFIVQHNVTGKGPFDNL+QHLSDPWHNTIVQTL GN Sbjct: 197 KEIANGRLAMLAFLGFIVQHNVTGKGPFDNLVQHLSDPWHNTIVQTLSGN 246 >AEX12937.1 hypothetical protein CL1595Contig1_02, partial [Pinus taeda] AEX12938.1 hypothetical protein CL1595Contig1_02, partial [Pinus taeda] AEX12939.1 hypothetical protein CL1595Contig1_02, partial [Pinus taeda] AEX12940.1 hypothetical protein CL1595Contig1_02, partial [Pinus taeda] AEX12941.1 hypothetical protein CL1595Contig1_02, partial [Pinus taeda] AEX12942.1 hypothetical protein CL1595Contig1_02, partial [Pinus taeda] AEX12943.1 hypothetical protein CL1595Contig1_02, partial [Pinus taeda] AEX12944.1 hypothetical protein CL1595Contig1_02, partial [Pinus taeda] AEX12945.1 hypothetical protein CL1595Contig1_02, partial [Pinus taeda] AEX12946.1 hypothetical protein CL1595Contig1_02, partial [Pinus taeda] AEX12947.1 hypothetical protein CL1595Contig1_02, partial [Pinus taeda] AEX12948.1 hypothetical protein CL1595Contig1_02, partial [Pinus taeda] AEX12949.1 hypothetical protein CL1595Contig1_02, partial [Pinus taeda] AEX12950.1 hypothetical protein CL1595Contig1_02, partial [Pinus taeda] Length = 60 Score = 99.0 bits (245), Expect = 9e-25 Identities = 44/49 (89%), Positives = 47/49 (95%) Frame = -1 Query: 438 KEIANGRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLGG 292 KE+ANGRLAMLAFLGF+VQHNVTGKGPFDNLLQHLSDPWHNTI+Q L G Sbjct: 11 KELANGRLAMLAFLGFVVQHNVTGKGPFDNLLQHLSDPWHNTIIQVLQG 59 >XP_006374459.1 hypothetical protein POPTR_0015s07340g [Populus trichocarpa] XP_006374460.1 hypothetical protein POPTR_0015s07340g [Populus trichocarpa] ERP52256.1 hypothetical protein POPTR_0015s07340g [Populus trichocarpa] ERP52257.1 hypothetical protein POPTR_0015s07340g [Populus trichocarpa] Length = 150 Score = 101 bits (252), Expect = 1e-24 Identities = 44/50 (88%), Positives = 48/50 (96%) Frame = -1 Query: 438 KEIANGRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLGGN 289 KE+ANGRLAMLAFLGF++QHNVTGKGPFDNLLQH+SDPWHNTIVQT GN Sbjct: 101 KELANGRLAMLAFLGFVIQHNVTGKGPFDNLLQHISDPWHNTIVQTFSGN 150 >OAY31051.1 hypothetical protein MANES_14G079800 [Manihot esculenta] Length = 252 Score = 104 bits (259), Expect = 1e-24 Identities = 47/50 (94%), Positives = 49/50 (98%) Frame = -1 Query: 438 KEIANGRLAMLAFLGFIVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLGGN 289 KE+ANGRLAMLAFLGF+VQHNVTGKGPFDNLLQHLSDPWHNTIVQTL GN Sbjct: 203 KELANGRLAMLAFLGFVVQHNVTGKGPFDNLLQHLSDPWHNTIVQTLSGN 252