BLASTX nr result
ID: Glycyrrhiza31_contig00002388
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00002388 (303 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AFM43814.1 soluble starch synthase, partial [Musa acuminata AAA ... 69 1e-13 AIM58808.1 putative soluble starch synthase, partial [Triticum a... 68 2e-13 CBI23544.3 unnamed protein product, partial [Vitis vinifera] 69 3e-13 XP_013462827.1 soluble starch synthase III-1 [Medicago truncatul... 74 4e-13 XP_013462828.1 soluble starch synthase III-1 [Medicago truncatul... 74 4e-13 XP_014518398.1 PREDICTED: starch synthase 3, chloroplastic/amylo... 74 4e-13 XP_017436039.1 PREDICTED: starch synthase 3, chloroplastic/amylo... 74 4e-13 BAT77377.1 hypothetical protein VIGAN_01548500 [Vigna angularis ... 69 5e-13 XP_006348120.1 PREDICTED: soluble starch synthase 3, chloroplast... 73 7e-13 XP_016487730.1 PREDICTED: soluble starch synthase 3, chloroplast... 73 7e-13 XP_009594930.1 PREDICTED: soluble starch synthase 3, chloroplast... 73 7e-13 XP_009785392.1 PREDICTED: soluble starch synthase 3, chloroplast... 73 7e-13 CAA64173.1 soluble-starch-synthase [Solanum tuberosum] 73 7e-13 Q43846.1 RecName: Full=Soluble starch synthase 3, chloroplastic/... 73 7e-13 NP_001274802.1 soluble starch synthase 3, chloroplastic/amylopla... 73 7e-13 XP_016487729.1 PREDICTED: soluble starch synthase 3, chloroplast... 73 7e-13 XP_009594929.1 PREDICTED: soluble starch synthase 3, chloroplast... 73 7e-13 XP_019267140.1 PREDICTED: soluble starch synthase 3, chloroplast... 73 7e-13 XP_009785391.1 PREDICTED: soluble starch synthase 3, chloroplast... 73 7e-13 KRH11435.1 hypothetical protein GLYMA_15G108000 [Glycine max] 72 1e-12 >AFM43814.1 soluble starch synthase, partial [Musa acuminata AAA Group] Length = 54 Score = 68.9 bits (167), Expect = 1e-13 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -2 Query: 302 FNTLCKRVMEQDWSWNRPALDYLELYHAARK 210 FN+LCKRVMEQDWSWNRPALDY+ELYH+ARK Sbjct: 24 FNSLCKRVMEQDWSWNRPALDYMELYHSARK 54 >AIM58808.1 putative soluble starch synthase, partial [Triticum aestivum] Length = 46 Score = 68.2 bits (165), Expect = 2e-13 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -2 Query: 302 FNTLCKRVMEQDWSWNRPALDYLELYHAARK 210 F++LCKRVMEQDWSWNRPALDY+ELYHAARK Sbjct: 15 FHSLCKRVMEQDWSWNRPALDYIELYHAARK 45 >CBI23544.3 unnamed protein product, partial [Vitis vinifera] Length = 83 Score = 68.6 bits (166), Expect = 3e-13 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -2 Query: 302 FNTLCKRVMEQDWSWNRPALDYLELYHAARK 210 FN+LCK+VMEQDWSWNRPALDY+ELYHAARK Sbjct: 53 FNSLCKQVMEQDWSWNRPALDYMELYHAARK 83 >XP_013462827.1 soluble starch synthase III-1 [Medicago truncatula] KEH36863.1 soluble starch synthase III-1 [Medicago truncatula] Length = 925 Score = 73.6 bits (179), Expect = 4e-13 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -2 Query: 302 FNTLCKRVMEQDWSWNRPALDYLELYHAARKLE 204 FNTLCK VMEQDWSWNRPALDYLELYHAARKLE Sbjct: 893 FNTLCKTVMEQDWSWNRPALDYLELYHAARKLE 925 >XP_013462828.1 soluble starch synthase III-1 [Medicago truncatula] KEH36862.1 soluble starch synthase III-1 [Medicago truncatula] Length = 1109 Score = 73.6 bits (179), Expect = 4e-13 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -2 Query: 302 FNTLCKRVMEQDWSWNRPALDYLELYHAARKLE 204 FNTLCK VMEQDWSWNRPALDYLELYHAARKLE Sbjct: 1077 FNTLCKTVMEQDWSWNRPALDYLELYHAARKLE 1109 >XP_014518398.1 PREDICTED: starch synthase 3, chloroplastic/amyloplastic-like [Vigna radiata var. radiata] Length = 1162 Score = 73.6 bits (179), Expect = 4e-13 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -2 Query: 302 FNTLCKRVMEQDWSWNRPALDYLELYHAARKLE 204 FN+LCKRVMEQDWSWNRPALDYLELYHAARK+E Sbjct: 1130 FNSLCKRVMEQDWSWNRPALDYLELYHAARKIE 1162 >XP_017436039.1 PREDICTED: starch synthase 3, chloroplastic/amyloplastic-like isoform X1 [Vigna angularis] XP_017436040.1 PREDICTED: starch synthase 3, chloroplastic/amyloplastic-like isoform X2 [Vigna angularis] KOM53420.1 hypothetical protein LR48_Vigan09g207900 [Vigna angularis] BAT87461.1 hypothetical protein VIGAN_05082900 [Vigna angularis var. angularis] Length = 1165 Score = 73.6 bits (179), Expect = 4e-13 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -2 Query: 302 FNTLCKRVMEQDWSWNRPALDYLELYHAARKLE 204 FN+LCKRVMEQDWSWNRPALDYLELYHAARK+E Sbjct: 1133 FNSLCKRVMEQDWSWNRPALDYLELYHAARKIE 1165 >BAT77377.1 hypothetical protein VIGAN_01548500 [Vigna angularis var. angularis] Length = 99 Score = 68.6 bits (166), Expect = 5e-13 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -2 Query: 302 FNTLCKRVMEQDWSWNRPALDYLELYHAARK 210 FN+LCK VMEQDWSWNRPALDYLELYHAARK Sbjct: 67 FNSLCKTVMEQDWSWNRPALDYLELYHAARK 97 >XP_006348120.1 PREDICTED: soluble starch synthase 3, chloroplastic/amyloplastic isoform X1 [Solanum tuberosum] Length = 1180 Score = 72.8 bits (177), Expect = 7e-13 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -2 Query: 302 FNTLCKRVMEQDWSWNRPALDYLELYHAARKLE 204 FN+LCK+VMEQDWSWNRPALDYLELYHAARKLE Sbjct: 1148 FNSLCKQVMEQDWSWNRPALDYLELYHAARKLE 1180 >XP_016487730.1 PREDICTED: soluble starch synthase 3, chloroplastic/amyloplastic isoform X2 [Nicotiana tabacum] Length = 1210 Score = 72.8 bits (177), Expect = 7e-13 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -2 Query: 302 FNTLCKRVMEQDWSWNRPALDYLELYHAARKLE 204 FN+LCK+VMEQDWSWNRPALDYLELYHAARKLE Sbjct: 1178 FNSLCKQVMEQDWSWNRPALDYLELYHAARKLE 1210 >XP_009594930.1 PREDICTED: soluble starch synthase 3, chloroplastic/amyloplastic isoform X2 [Nicotiana tomentosiformis] Length = 1210 Score = 72.8 bits (177), Expect = 7e-13 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -2 Query: 302 FNTLCKRVMEQDWSWNRPALDYLELYHAARKLE 204 FN+LCK+VMEQDWSWNRPALDYLELYHAARKLE Sbjct: 1178 FNSLCKQVMEQDWSWNRPALDYLELYHAARKLE 1210 >XP_009785392.1 PREDICTED: soluble starch synthase 3, chloroplastic/amyloplastic isoform X2 [Nicotiana sylvestris] Length = 1216 Score = 72.8 bits (177), Expect = 7e-13 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -2 Query: 302 FNTLCKRVMEQDWSWNRPALDYLELYHAARKLE 204 FN+LCK+VMEQDWSWNRPALDYLELYHAARKLE Sbjct: 1184 FNSLCKQVMEQDWSWNRPALDYLELYHAARKLE 1216 >CAA64173.1 soluble-starch-synthase [Solanum tuberosum] Length = 1230 Score = 72.8 bits (177), Expect = 7e-13 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -2 Query: 302 FNTLCKRVMEQDWSWNRPALDYLELYHAARKLE 204 FN+LCK+VMEQDWSWNRPALDYLELYHAARKLE Sbjct: 1198 FNSLCKQVMEQDWSWNRPALDYLELYHAARKLE 1230 >Q43846.1 RecName: Full=Soluble starch synthase 3, chloroplastic/amyloplastic; AltName: Full=Soluble starch synthase III; Short=SS III; Flags: Precursor CAA65065.1 glycogen (starch) synthase [Solanum tuberosum] Length = 1230 Score = 72.8 bits (177), Expect = 7e-13 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -2 Query: 302 FNTLCKRVMEQDWSWNRPALDYLELYHAARKLE 204 FN+LCK+VMEQDWSWNRPALDYLELYHAARKLE Sbjct: 1198 FNSLCKQVMEQDWSWNRPALDYLELYHAARKLE 1230 >NP_001274802.1 soluble starch synthase 3, chloroplastic/amyloplastic [Solanum tuberosum] ACT83376.1 soluble starch synthase [Solanum tuberosum] Length = 1230 Score = 72.8 bits (177), Expect = 7e-13 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -2 Query: 302 FNTLCKRVMEQDWSWNRPALDYLELYHAARKLE 204 FN+LCK+VMEQDWSWNRPALDYLELYHAARKLE Sbjct: 1198 FNSLCKQVMEQDWSWNRPALDYLELYHAARKLE 1230 >XP_016487729.1 PREDICTED: soluble starch synthase 3, chloroplastic/amyloplastic isoform X1 [Nicotiana tabacum] Length = 1243 Score = 72.8 bits (177), Expect = 7e-13 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -2 Query: 302 FNTLCKRVMEQDWSWNRPALDYLELYHAARKLE 204 FN+LCK+VMEQDWSWNRPALDYLELYHAARKLE Sbjct: 1211 FNSLCKQVMEQDWSWNRPALDYLELYHAARKLE 1243 >XP_009594929.1 PREDICTED: soluble starch synthase 3, chloroplastic/amyloplastic isoform X1 [Nicotiana tomentosiformis] Length = 1243 Score = 72.8 bits (177), Expect = 7e-13 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -2 Query: 302 FNTLCKRVMEQDWSWNRPALDYLELYHAARKLE 204 FN+LCK+VMEQDWSWNRPALDYLELYHAARKLE Sbjct: 1211 FNSLCKQVMEQDWSWNRPALDYLELYHAARKLE 1243 >XP_019267140.1 PREDICTED: soluble starch synthase 3, chloroplastic/amyloplastic [Nicotiana attenuata] OIT05624.1 soluble starch synthase 3, chloroplasticamyloplastic [Nicotiana attenuata] Length = 1249 Score = 72.8 bits (177), Expect = 7e-13 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -2 Query: 302 FNTLCKRVMEQDWSWNRPALDYLELYHAARKLE 204 FN+LCK+VMEQDWSWNRPALDYLELYHAARKLE Sbjct: 1217 FNSLCKQVMEQDWSWNRPALDYLELYHAARKLE 1249 >XP_009785391.1 PREDICTED: soluble starch synthase 3, chloroplastic/amyloplastic isoform X1 [Nicotiana sylvestris] XP_016445626.1 PREDICTED: soluble starch synthase 3, chloroplastic/amyloplastic-like [Nicotiana tabacum] Length = 1249 Score = 72.8 bits (177), Expect = 7e-13 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -2 Query: 302 FNTLCKRVMEQDWSWNRPALDYLELYHAARKLE 204 FN+LCK+VMEQDWSWNRPALDYLELYHAARKLE Sbjct: 1217 FNSLCKQVMEQDWSWNRPALDYLELYHAARKLE 1249 >KRH11435.1 hypothetical protein GLYMA_15G108000 [Glycine max] Length = 898 Score = 72.4 bits (176), Expect = 1e-12 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -2 Query: 302 FNTLCKRVMEQDWSWNRPALDYLELYHAARKLE 204 FN+LCKRVMEQDWSWNRPALDYLELYHAARK E Sbjct: 866 FNSLCKRVMEQDWSWNRPALDYLELYHAARKAE 898