BLASTX nr result
ID: Glycyrrhiza31_contig00002365
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00002365 (860 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KRH73606.1 hypothetical protein GLYMA_02G283300 [Glycine max] 71 3e-10 XP_003519533.1 PREDICTED: regulatory protein NPR3-like [Glycine ... 71 3e-10 KYP73330.1 Regulatory protein NPR1 [Cajanus cajan] 69 1e-09 XP_014622709.1 PREDICTED: regulatory protein NPR3-like isoform X... 69 2e-09 XP_007141442.1 hypothetical protein PHAVU_008G195900g [Phaseolus... 69 2e-09 KHN11992.1 Regulatory protein NPR3 [Glycine soja] 69 2e-09 XP_014622707.1 PREDICTED: regulatory protein NPR3-like isoform X... 69 2e-09 XP_013454365.1 NPR1/NIM1-like regulatory protein, putative [Medi... 65 3e-08 XP_014502510.1 PREDICTED: regulatory protein NPR3-like [Vigna ra... 65 3e-08 XP_003617362.1 NPR1/NIM1-like regulatory protein, putative [Medi... 65 3e-08 XP_012568651.1 PREDICTED: regulatory protein NPR3-like [Cicer ar... 63 2e-07 KOM46587.1 hypothetical protein LR48_Vigan07g029100 [Vigna angul... 62 2e-07 XP_017431244.1 PREDICTED: regulatory protein NPR3-like isoform X... 62 2e-07 GAU22204.1 hypothetical protein TSUD_252320 [Trifolium subterran... 61 6e-07 XP_015973270.1 PREDICTED: regulatory protein NPR3-like [Arachis ... 61 6e-07 XP_016166205.1 PREDICTED: regulatory protein NPR3-like [Arachis ... 60 9e-07 OMP07569.1 NPR1/NIM1-like regulatory protein [Corchorus olitorius] 55 1e-06 XP_011032773.1 PREDICTED: regulatory protein NPR3-like [Populus ... 60 1e-06 XP_002300863.2 hypothetical protein POPTR_0002s05740g, partial [... 59 2e-06 XP_019435348.1 PREDICTED: regulatory protein NPR3-like [Lupinus ... 59 3e-06 >KRH73606.1 hypothetical protein GLYMA_02G283300 [Glycine max] Length = 507 Score = 71.2 bits (173), Expect = 3e-10 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -1 Query: 119 GANIEVLSLNKLSGSLEKLLSDAEYDYSDAEILVEDIPV 3 GANIE+LSLNKLSGSLEKLL + EYDYSDAEILVEDIPV Sbjct: 36 GANIEILSLNKLSGSLEKLLIETEYDYSDAEILVEDIPV 74 >XP_003519533.1 PREDICTED: regulatory protein NPR3-like [Glycine max] XP_006575639.1 PREDICTED: regulatory protein NPR3-like [Glycine max] XP_006575640.1 PREDICTED: regulatory protein NPR3-like [Glycine max] KRH73603.1 hypothetical protein GLYMA_02G283300 [Glycine max] KRH73604.1 hypothetical protein GLYMA_02G283300 [Glycine max] KRH73605.1 hypothetical protein GLYMA_02G283300 [Glycine max] Length = 590 Score = 71.2 bits (173), Expect = 3e-10 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -1 Query: 119 GANIEVLSLNKLSGSLEKLLSDAEYDYSDAEILVEDIPV 3 GANIE+LSLNKLSGSLEKLL + EYDYSDAEILVEDIPV Sbjct: 36 GANIEILSLNKLSGSLEKLLIETEYDYSDAEILVEDIPV 74 >KYP73330.1 Regulatory protein NPR1 [Cajanus cajan] Length = 615 Score = 69.3 bits (168), Expect = 1e-09 Identities = 35/39 (89%), Positives = 37/39 (94%) Frame = -1 Query: 119 GANIEVLSLNKLSGSLEKLLSDAEYDYSDAEILVEDIPV 3 GANIE+LSL+KLSGSLEKLL DAEYDYSDAEILVEDI V Sbjct: 36 GANIEILSLSKLSGSLEKLLIDAEYDYSDAEILVEDISV 74 >XP_014622709.1 PREDICTED: regulatory protein NPR3-like isoform X2 [Glycine max] Length = 581 Score = 68.9 bits (167), Expect = 2e-09 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -1 Query: 119 GANIEVLSLNKLSGSLEKLLSDAEYDYSDAEILVEDIPV 3 G NIE+LSLNKLSGSLEKLL + EYDYSDAEIL+EDIPV Sbjct: 36 GENIEILSLNKLSGSLEKLLIEVEYDYSDAEILIEDIPV 74 >XP_007141442.1 hypothetical protein PHAVU_008G195900g [Phaseolus vulgaris] ESW13436.1 hypothetical protein PHAVU_008G195900g [Phaseolus vulgaris] Length = 588 Score = 68.9 bits (167), Expect = 2e-09 Identities = 34/39 (87%), Positives = 37/39 (94%) Frame = -1 Query: 119 GANIEVLSLNKLSGSLEKLLSDAEYDYSDAEILVEDIPV 3 GANIE+L+LNKLSGSLEKLL DAEYDYSDAEI+VEDI V Sbjct: 36 GANIEILTLNKLSGSLEKLLIDAEYDYSDAEIVVEDISV 74 >KHN11992.1 Regulatory protein NPR3 [Glycine soja] Length = 590 Score = 68.9 bits (167), Expect = 2e-09 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -1 Query: 119 GANIEVLSLNKLSGSLEKLLSDAEYDYSDAEILVEDIPV 3 G NIE+LSLNKLSGSLEKLL + EYDYSDAEIL+EDIPV Sbjct: 36 GENIEILSLNKLSGSLEKLLIEVEYDYSDAEILIEDIPV 74 >XP_014622707.1 PREDICTED: regulatory protein NPR3-like isoform X1 [Glycine max] XP_014622708.1 PREDICTED: regulatory protein NPR3-like isoform X1 [Glycine max] KRH14520.1 hypothetical protein GLYMA_14G031300 [Glycine max] Length = 590 Score = 68.9 bits (167), Expect = 2e-09 Identities = 33/39 (84%), Positives = 36/39 (92%) Frame = -1 Query: 119 GANIEVLSLNKLSGSLEKLLSDAEYDYSDAEILVEDIPV 3 G NIE+LSLNKLSGSLEKLL + EYDYSDAEIL+EDIPV Sbjct: 36 GENIEILSLNKLSGSLEKLLIEVEYDYSDAEILIEDIPV 74 >XP_013454365.1 NPR1/NIM1-like regulatory protein, putative [Medicago truncatula] KEH28396.1 NPR1/NIM1-like regulatory protein, putative [Medicago truncatula] Length = 456 Score = 65.1 bits (157), Expect = 3e-08 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = -1 Query: 116 ANIEVLSLNKLSGSLEKLLSDAEYDYSDAEILVEDIPV 3 AN E++SLNKLSGSLEKLLSD +YDY DAEILVE+IPV Sbjct: 41 ANTEIVSLNKLSGSLEKLLSDVDYDYCDAEILVEEIPV 78 >XP_014502510.1 PREDICTED: regulatory protein NPR3-like [Vigna radiata var. radiata] Length = 594 Score = 65.1 bits (157), Expect = 3e-08 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = -1 Query: 116 ANIEVLSLNKLSGSLEKLLSDAEYDYSDAEILVEDIPV 3 ANIE+L+L+KLSGSLEKLL DAEYDYSDAEILVEDI V Sbjct: 42 ANIEILTLSKLSGSLEKLLIDAEYDYSDAEILVEDICV 79 >XP_003617362.1 NPR1/NIM1-like regulatory protein, putative [Medicago truncatula] AET00321.1 NPR1/NIM1-like regulatory protein, putative [Medicago truncatula] Length = 594 Score = 65.1 bits (157), Expect = 3e-08 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = -1 Query: 116 ANIEVLSLNKLSGSLEKLLSDAEYDYSDAEILVEDIPV 3 AN E++SLNKLSGSLEKLLSD +YDY DAEILVE+IPV Sbjct: 41 ANTEIVSLNKLSGSLEKLLSDVDYDYCDAEILVEEIPV 78 >XP_012568651.1 PREDICTED: regulatory protein NPR3-like [Cicer arietinum] Length = 571 Score = 62.8 bits (151), Expect = 2e-07 Identities = 32/40 (80%), Positives = 36/40 (90%), Gaps = 1/40 (2%) Frame = -1 Query: 119 GANIEVLSLNKLSGSLEKL-LSDAEYDYSDAEILVEDIPV 3 GANIE++SLNKLSGSLEKL L D +YDY DAEILVE+IPV Sbjct: 39 GANIEIVSLNKLSGSLEKLILGDIDYDYCDAEILVEEIPV 78 >KOM46587.1 hypothetical protein LR48_Vigan07g029100 [Vigna angularis] Length = 580 Score = 62.4 bits (150), Expect = 2e-07 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = -1 Query: 116 ANIEVLSLNKLSGSLEKLLSDAEYDYSDAEILVEDIPV 3 ANIE+L+L+KLSG LEKLL DAEYDYSDAEILVED+ V Sbjct: 37 ANIEILTLSKLSGGLEKLLIDAEYDYSDAEILVEDMCV 74 >XP_017431244.1 PREDICTED: regulatory protein NPR3-like isoform X1 [Vigna angularis] XP_017431245.1 PREDICTED: regulatory protein NPR3-like isoform X2 [Vigna angularis] BAT80808.1 hypothetical protein VIGAN_03041800 [Vigna angularis var. angularis] Length = 594 Score = 62.4 bits (150), Expect = 2e-07 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = -1 Query: 116 ANIEVLSLNKLSGSLEKLLSDAEYDYSDAEILVEDIPV 3 ANIE+L+L+KLSG LEKLL DAEYDYSDAEILVED+ V Sbjct: 42 ANIEILTLSKLSGGLEKLLIDAEYDYSDAEILVEDMCV 79 >GAU22204.1 hypothetical protein TSUD_252320 [Trifolium subterraneum] Length = 559 Score = 61.2 bits (147), Expect = 6e-07 Identities = 31/39 (79%), Positives = 36/39 (92%), Gaps = 1/39 (2%) Frame = -1 Query: 116 ANIEVLSLNKLSGSLEKLL-SDAEYDYSDAEILVEDIPV 3 ANIE++SLNKLSGSLEKLL SD +YDY DAEI+VE+IPV Sbjct: 33 ANIEIVSLNKLSGSLEKLLLSDVDYDYCDAEIVVEEIPV 71 >XP_015973270.1 PREDICTED: regulatory protein NPR3-like [Arachis duranensis] Length = 600 Score = 61.2 bits (147), Expect = 6e-07 Identities = 31/39 (79%), Positives = 33/39 (84%) Frame = -1 Query: 119 GANIEVLSLNKLSGSLEKLLSDAEYDYSDAEILVEDIPV 3 G IE+LSL KLS SLEKLL DA+YDYSDAEILVE IPV Sbjct: 42 GGGIEILSLKKLSTSLEKLLIDADYDYSDAEILVEGIPV 80 >XP_016166205.1 PREDICTED: regulatory protein NPR3-like [Arachis ipaensis] Length = 463 Score = 60.5 bits (145), Expect = 9e-07 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = -1 Query: 119 GANIEVLSLNKLSGSLEKLLSDAEYDYSDAEILVEDIPV 3 G IE+LSL KLS SLEKL+ DA+YDYSDAEILVE IPV Sbjct: 42 GGGIEILSLKKLSTSLEKLMIDADYDYSDAEILVEGIPV 80 >OMP07569.1 NPR1/NIM1-like regulatory protein [Corchorus olitorius] Length = 77 Score = 55.5 bits (132), Expect = 1e-06 Identities = 27/34 (79%), Positives = 30/34 (88%) Frame = -1 Query: 116 ANIEVLSLNKLSGSLEKLLSDAEYDYSDAEILVE 15 +N+E LSLNKLS SLEKLL D EYDYSDAEI+VE Sbjct: 37 SNLETLSLNKLSSSLEKLLLDEEYDYSDAEIVVE 70 >XP_011032773.1 PREDICTED: regulatory protein NPR3-like [Populus euphratica] Length = 586 Score = 60.1 bits (144), Expect = 1e-06 Identities = 29/39 (74%), Positives = 34/39 (87%) Frame = -1 Query: 119 GANIEVLSLNKLSGSLEKLLSDAEYDYSDAEILVEDIPV 3 G N+E LSL+KLSG+LE+LL D EYDYSDAEI+VE IPV Sbjct: 37 GVNLENLSLSKLSGNLERLLLDGEYDYSDAEIVVEGIPV 75 >XP_002300863.2 hypothetical protein POPTR_0002s05740g, partial [Populus trichocarpa] EEE80136.2 hypothetical protein POPTR_0002s05740g, partial [Populus trichocarpa] Length = 435 Score = 59.3 bits (142), Expect = 2e-06 Identities = 29/39 (74%), Positives = 32/39 (82%) Frame = -1 Query: 119 GANIEVLSLNKLSGSLEKLLSDAEYDYSDAEILVEDIPV 3 G N+E LSLNKLSG+LE+LL D EYDYSDAEI VE PV Sbjct: 37 GVNLENLSLNKLSGNLERLLLDKEYDYSDAEIFVEGTPV 75 >XP_019435348.1 PREDICTED: regulatory protein NPR3-like [Lupinus angustifolius] XP_019435349.1 PREDICTED: regulatory protein NPR3-like [Lupinus angustifolius] OIW22017.1 hypothetical protein TanjilG_29206 [Lupinus angustifolius] Length = 591 Score = 59.3 bits (142), Expect = 3e-06 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = -1 Query: 116 ANIEVLSLNKLSGSLEKLLSDAEYDYSDAEILVEDIPV 3 AN EVLSL++LSGSLEKLL D+EYDYSDAEILVE + V Sbjct: 40 ANTEVLSLSRLSGSLEKLLIDSEYDYSDAEILVEGMSV 77