BLASTX nr result
ID: Glycyrrhiza31_contig00001545
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00001545 (509 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value NP_001242405.1 phytoene synthase, chloroplastic-like [Glycine ma... 238 7e-75 XP_015931720.1 PREDICTED: phytoene synthase 2, chloroplastic [Ar... 238 1e-74 KHN41025.1 Phytoene synthase, chloroplastic [Glycine soja] 238 2e-74 XP_006574393.1 PREDICTED: uncharacterized protein LOC100780932 i... 238 2e-74 XP_016166294.1 PREDICTED: phytoene synthase 2, chloroplastic [Ar... 237 6e-74 KRH17267.1 hypothetical protein GLYMA_14G209700 [Glycine max] 234 4e-73 KHN39504.1 Phytoene synthase, chloroplastic [Glycine soja] 234 4e-73 XP_014504995.1 PREDICTED: phytoene synthase 2, chloroplastic [Vi... 231 7e-72 XP_012568501.1 PREDICTED: phytoene synthase 2, chloroplastic [Ci... 230 2e-71 KYP48364.1 hypothetical protein KK1_029976 [Cajanus cajan] 230 4e-71 XP_017430735.1 PREDICTED: phytoene synthase 2, chloroplastic [Vi... 229 5e-71 XP_007141971.1 hypothetical protein PHAVU_008G241500g [Phaseolus... 226 1e-69 XP_019460948.1 PREDICTED: phytoene synthase 2, chloroplastic-lik... 224 3e-69 XP_019432581.1 PREDICTED: phytoene synthase 2, chloroplastic-lik... 223 1e-68 AIU48707.1 phytoene synthase, partial [Glycine max] 216 4e-67 XP_003616147.1 squalene/phytoene synthase [Medicago truncatula] ... 218 1e-66 AAX33349.1 phytoene synthase 1, partial [Prunus armeniaca] 208 1e-65 ACY42670.1 phytoene synthase 2 [Manihot esculenta] 213 7e-65 ACY42669.1 phytoene synthase 2 [Manihot esculenta] 213 7e-65 ACY42665.1 phytoene synthase 2 [Manihot esculenta] ACY42667.1 ph... 213 7e-65 >NP_001242405.1 phytoene synthase, chloroplastic-like [Glycine max] ACU17983.1 unknown [Glycine max] Length = 399 Score = 238 bits (607), Expect = 7e-75 Identities = 117/122 (95%), Positives = 120/122 (98%) Frame = -1 Query: 509 ASRGRVYLPQDELAQAGLSDNDIFSGKVTDKWRNFMKSQIKRARMFFDEAEKGVTELNEA 330 ASRGRVYLPQDELAQAGLSD DIF+GKVTDKWRNFMKSQIKRARMFFDEAEKGVTELNEA Sbjct: 277 ASRGRVYLPQDELAQAGLSDEDIFAGKVTDKWRNFMKSQIKRARMFFDEAEKGVTELNEA 336 Query: 329 SRWPVWASLLLYRQILDEIEANDYNNFTKRAYVSKAKKLLSLPAAYARSVVPPSRKLSPV 150 SRWPVWASLLLYRQILDEIEANDYNNFT+RAYVSKAKK LSLPAAYARS+VPPSRKLSPV Sbjct: 337 SRWPVWASLLLYRQILDEIEANDYNNFTRRAYVSKAKKFLSLPAAYARSIVPPSRKLSPV 396 Query: 149 MK 144 MK Sbjct: 397 MK 398 >XP_015931720.1 PREDICTED: phytoene synthase 2, chloroplastic [Arachis duranensis] XP_015931721.1 PREDICTED: phytoene synthase 2, chloroplastic [Arachis duranensis] XP_015931722.1 PREDICTED: phytoene synthase 2, chloroplastic [Arachis duranensis] XP_015931723.1 PREDICTED: phytoene synthase 2, chloroplastic [Arachis duranensis] Length = 437 Score = 238 bits (608), Expect = 1e-74 Identities = 118/123 (95%), Positives = 120/123 (97%) Frame = -1 Query: 509 ASRGRVYLPQDELAQAGLSDNDIFSGKVTDKWRNFMKSQIKRARMFFDEAEKGVTELNEA 330 ASRGRVYLPQDELAQAGLSD DIF+GKVTDKWRNFMKSQIKRARMFFDEAEKGVTELNEA Sbjct: 315 ASRGRVYLPQDELAQAGLSDEDIFAGKVTDKWRNFMKSQIKRARMFFDEAEKGVTELNEA 374 Query: 329 SRWPVWASLLLYRQILDEIEANDYNNFTKRAYVSKAKKLLSLPAAYARSVVPPSRKLSPV 150 SRWPVWASLLLYRQILDEIEANDYNNFTKRAYVSKAKKL SLP AYARS+VPPSRKLSPV Sbjct: 375 SRWPVWASLLLYRQILDEIEANDYNNFTKRAYVSKAKKLFSLPTAYARSMVPPSRKLSPV 434 Query: 149 MKA 141 MKA Sbjct: 435 MKA 437 >KHN41025.1 Phytoene synthase, chloroplastic [Glycine soja] Length = 436 Score = 238 bits (607), Expect = 2e-74 Identities = 117/122 (95%), Positives = 120/122 (98%) Frame = -1 Query: 509 ASRGRVYLPQDELAQAGLSDNDIFSGKVTDKWRNFMKSQIKRARMFFDEAEKGVTELNEA 330 ASRGRVYLPQDELAQAGLSD DIF+GKVTDKWRNFMKSQIKRARMFFDEAEKGVTELNEA Sbjct: 314 ASRGRVYLPQDELAQAGLSDEDIFAGKVTDKWRNFMKSQIKRARMFFDEAEKGVTELNEA 373 Query: 329 SRWPVWASLLLYRQILDEIEANDYNNFTKRAYVSKAKKLLSLPAAYARSVVPPSRKLSPV 150 SRWPVWASLLLYRQILDEIEANDYNNFT+RAYVSKAKK LSLPAAYARS+VPPSRKLSPV Sbjct: 374 SRWPVWASLLLYRQILDEIEANDYNNFTRRAYVSKAKKFLSLPAAYARSIVPPSRKLSPV 433 Query: 149 MK 144 MK Sbjct: 434 MK 435 >XP_006574393.1 PREDICTED: uncharacterized protein LOC100780932 isoform X1 [Glycine max] XP_006574394.1 PREDICTED: uncharacterized protein LOC100780932 isoform X1 [Glycine max] XP_006574395.1 PREDICTED: uncharacterized protein LOC100780932 isoform X1 [Glycine max] XP_006574396.1 PREDICTED: uncharacterized protein LOC100780932 isoform X1 [Glycine max] KRH72908.1 hypothetical protein GLYMA_02G240200 [Glycine max] KRH72909.1 hypothetical protein GLYMA_02G240200 [Glycine max] KRH72910.1 hypothetical protein GLYMA_02G240200 [Glycine max] KRH72911.1 hypothetical protein GLYMA_02G240200 [Glycine max] Length = 436 Score = 238 bits (607), Expect = 2e-74 Identities = 117/122 (95%), Positives = 120/122 (98%) Frame = -1 Query: 509 ASRGRVYLPQDELAQAGLSDNDIFSGKVTDKWRNFMKSQIKRARMFFDEAEKGVTELNEA 330 ASRGRVYLPQDELAQAGLSD DIF+GKVTDKWRNFMKSQIKRARMFFDEAEKGVTELNEA Sbjct: 314 ASRGRVYLPQDELAQAGLSDEDIFAGKVTDKWRNFMKSQIKRARMFFDEAEKGVTELNEA 373 Query: 329 SRWPVWASLLLYRQILDEIEANDYNNFTKRAYVSKAKKLLSLPAAYARSVVPPSRKLSPV 150 SRWPVWASLLLYRQILDEIEANDYNNFT+RAYVSKAKK LSLPAAYARS+VPPSRKLSPV Sbjct: 374 SRWPVWASLLLYRQILDEIEANDYNNFTRRAYVSKAKKFLSLPAAYARSIVPPSRKLSPV 433 Query: 149 MK 144 MK Sbjct: 434 MK 435 >XP_016166294.1 PREDICTED: phytoene synthase 2, chloroplastic [Arachis ipaensis] XP_016166295.1 PREDICTED: phytoene synthase 2, chloroplastic [Arachis ipaensis] XP_016166296.1 PREDICTED: phytoene synthase 2, chloroplastic [Arachis ipaensis] XP_016166298.1 PREDICTED: phytoene synthase 2, chloroplastic [Arachis ipaensis] Length = 437 Score = 237 bits (604), Expect = 6e-74 Identities = 117/123 (95%), Positives = 119/123 (96%) Frame = -1 Query: 509 ASRGRVYLPQDELAQAGLSDNDIFSGKVTDKWRNFMKSQIKRARMFFDEAEKGVTELNEA 330 ASRGRVYLPQDELAQAGLSD DIF+GKVTDKWRNFMKSQIKRARMFFDEAEKGVTELNEA Sbjct: 315 ASRGRVYLPQDELAQAGLSDEDIFAGKVTDKWRNFMKSQIKRARMFFDEAEKGVTELNEA 374 Query: 329 SRWPVWASLLLYRQILDEIEANDYNNFTKRAYVSKAKKLLSLPAAYARSVVPPSRKLSPV 150 SRWPVWASLLLYRQILDEIEANDYNNFTKRAYVSKAKKL SLP AYARS+VPPSRKLSP Sbjct: 375 SRWPVWASLLLYRQILDEIEANDYNNFTKRAYVSKAKKLFSLPTAYARSMVPPSRKLSPA 434 Query: 149 MKA 141 MKA Sbjct: 435 MKA 437 >KRH17267.1 hypothetical protein GLYMA_14G209700 [Glycine max] Length = 433 Score = 234 bits (598), Expect = 4e-73 Identities = 116/122 (95%), Positives = 120/122 (98%) Frame = -1 Query: 509 ASRGRVYLPQDELAQAGLSDNDIFSGKVTDKWRNFMKSQIKRARMFFDEAEKGVTELNEA 330 ASRGRVYLPQDELAQAGLSD DIF+GKVTDKWRNFMKSQIKRARMFFDEAEKGVTELNEA Sbjct: 311 ASRGRVYLPQDELAQAGLSDEDIFAGKVTDKWRNFMKSQIKRARMFFDEAEKGVTELNEA 370 Query: 329 SRWPVWASLLLYRQILDEIEANDYNNFTKRAYVSKAKKLLSLPAAYARSVVPPSRKLSPV 150 SRWPVWASLLLYRQILDEIEANDYNNFT+RAYVSKAKKLLSLPAAYARS+VPPS+KLS V Sbjct: 371 SRWPVWASLLLYRQILDEIEANDYNNFTRRAYVSKAKKLLSLPAAYARSMVPPSKKLSSV 430 Query: 149 MK 144 MK Sbjct: 431 MK 432 >KHN39504.1 Phytoene synthase, chloroplastic [Glycine soja] Length = 436 Score = 234 bits (598), Expect = 4e-73 Identities = 116/122 (95%), Positives = 120/122 (98%) Frame = -1 Query: 509 ASRGRVYLPQDELAQAGLSDNDIFSGKVTDKWRNFMKSQIKRARMFFDEAEKGVTELNEA 330 ASRGRVYLPQDELAQAGLSD DIF+GKVTDKWRNFMKSQIKRARMFFDEAEKGVTELNEA Sbjct: 314 ASRGRVYLPQDELAQAGLSDEDIFAGKVTDKWRNFMKSQIKRARMFFDEAEKGVTELNEA 373 Query: 329 SRWPVWASLLLYRQILDEIEANDYNNFTKRAYVSKAKKLLSLPAAYARSVVPPSRKLSPV 150 SRWPVWASLLLYRQILDEIEANDYNNFT+RAYVSKAKKLLSLPAAYARS+VPPS+KLS V Sbjct: 374 SRWPVWASLLLYRQILDEIEANDYNNFTRRAYVSKAKKLLSLPAAYARSMVPPSKKLSSV 433 Query: 149 MK 144 MK Sbjct: 434 MK 435 >XP_014504995.1 PREDICTED: phytoene synthase 2, chloroplastic [Vigna radiata var. radiata] XP_014504996.1 PREDICTED: phytoene synthase 2, chloroplastic [Vigna radiata var. radiata] XP_014504997.1 PREDICTED: phytoene synthase 2, chloroplastic [Vigna radiata var. radiata] Length = 435 Score = 231 bits (590), Expect = 7e-72 Identities = 114/122 (93%), Positives = 119/122 (97%) Frame = -1 Query: 509 ASRGRVYLPQDELAQAGLSDNDIFSGKVTDKWRNFMKSQIKRARMFFDEAEKGVTELNEA 330 ASRGRVYLPQDELAQAGLSD+DIF+GKVTDKWRNFMKSQIKRARMFFDEAEKGVTELNEA Sbjct: 313 ASRGRVYLPQDELAQAGLSDDDIFAGKVTDKWRNFMKSQIKRARMFFDEAEKGVTELNEA 372 Query: 329 SRWPVWASLLLYRQILDEIEANDYNNFTKRAYVSKAKKLLSLPAAYARSVVPPSRKLSPV 150 SRWPVWASLLLYRQILDEIEANDYNNFT+RAYVSKAKK LSLP A+ARSVVPPS+ LSPV Sbjct: 373 SRWPVWASLLLYRQILDEIEANDYNNFTRRAYVSKAKKFLSLPVAFARSVVPPSKILSPV 432 Query: 149 MK 144 MK Sbjct: 433 MK 434 >XP_012568501.1 PREDICTED: phytoene synthase 2, chloroplastic [Cicer arietinum] XP_012568502.1 PREDICTED: phytoene synthase 2, chloroplastic [Cicer arietinum] XP_012568503.1 PREDICTED: phytoene synthase 2, chloroplastic [Cicer arietinum] Length = 436 Score = 230 bits (587), Expect = 2e-71 Identities = 115/123 (93%), Positives = 118/123 (95%) Frame = -1 Query: 509 ASRGRVYLPQDELAQAGLSDNDIFSGKVTDKWRNFMKSQIKRARMFFDEAEKGVTELNEA 330 A RGRVYLPQDELAQAGLSD+DIF+GKVTDKWRNFMKSQIKRARMFFDEAEKGVTELNEA Sbjct: 314 ARRGRVYLPQDELAQAGLSDDDIFAGKVTDKWRNFMKSQIKRARMFFDEAEKGVTELNEA 373 Query: 329 SRWPVWASLLLYRQILDEIEANDYNNFTKRAYVSKAKKLLSLPAAYARSVVPPSRKLSPV 150 SRWPVWASLLLYRQILDEIEANDYN FTKRAYVSKAKKLLSLP AYARS+VPPSRKL V Sbjct: 374 SRWPVWASLLLYRQILDEIEANDYNTFTKRAYVSKAKKLLSLPMAYARSMVPPSRKLPHV 433 Query: 149 MKA 141 MKA Sbjct: 434 MKA 436 >KYP48364.1 hypothetical protein KK1_029976 [Cajanus cajan] Length = 449 Score = 230 bits (586), Expect = 4e-71 Identities = 113/122 (92%), Positives = 119/122 (97%) Frame = -1 Query: 509 ASRGRVYLPQDELAQAGLSDNDIFSGKVTDKWRNFMKSQIKRARMFFDEAEKGVTELNEA 330 ASRGRVYLPQDELAQAGLSD+DIF+GKVTDKWRNFMK+QIKRAR FFDEAEKGVTELNEA Sbjct: 327 ASRGRVYLPQDELAQAGLSDDDIFAGKVTDKWRNFMKNQIKRARTFFDEAEKGVTELNEA 386 Query: 329 SRWPVWASLLLYRQILDEIEANDYNNFTKRAYVSKAKKLLSLPAAYARSVVPPSRKLSPV 150 SRWPVWASLLLYRQILDEIEANDYNNFT+RAYVSKAKKLLSLP AYARS+VPPSRKLS + Sbjct: 387 SRWPVWASLLLYRQILDEIEANDYNNFTRRAYVSKAKKLLSLPNAYARSMVPPSRKLSSI 446 Query: 149 MK 144 MK Sbjct: 447 MK 448 >XP_017430735.1 PREDICTED: phytoene synthase 2, chloroplastic [Vigna angularis] XP_017430736.1 PREDICTED: phytoene synthase 2, chloroplastic [Vigna angularis] XP_017430737.1 PREDICTED: phytoene synthase 2, chloroplastic [Vigna angularis] XP_017430738.1 PREDICTED: phytoene synthase 2, chloroplastic [Vigna angularis] KOM47099.1 hypothetical protein LR48_Vigan07g080300 [Vigna angularis] BAT81313.1 hypothetical protein VIGAN_03100300 [Vigna angularis var. angularis] Length = 435 Score = 229 bits (584), Expect = 5e-71 Identities = 112/122 (91%), Positives = 118/122 (96%) Frame = -1 Query: 509 ASRGRVYLPQDELAQAGLSDNDIFSGKVTDKWRNFMKSQIKRARMFFDEAEKGVTELNEA 330 ASRGRVYLPQDELAQAGLSD+DIF+GKVTDKWRNFMKSQIKRARMFFDEAEKGVTELNEA Sbjct: 313 ASRGRVYLPQDELAQAGLSDDDIFAGKVTDKWRNFMKSQIKRARMFFDEAEKGVTELNEA 372 Query: 329 SRWPVWASLLLYRQILDEIEANDYNNFTKRAYVSKAKKLLSLPAAYARSVVPPSRKLSPV 150 SRWPVWASLLLYRQILDEIEANDYNNFT+RAYV KAKK LSLP A+ARS+VPPS+ LSPV Sbjct: 373 SRWPVWASLLLYRQILDEIEANDYNNFTRRAYVGKAKKFLSLPVAFARSMVPPSKVLSPV 432 Query: 149 MK 144 MK Sbjct: 433 MK 434 >XP_007141971.1 hypothetical protein PHAVU_008G241500g [Phaseolus vulgaris] XP_007141972.1 hypothetical protein PHAVU_008G241500g [Phaseolus vulgaris] ESW13965.1 hypothetical protein PHAVU_008G241500g [Phaseolus vulgaris] ESW13966.1 hypothetical protein PHAVU_008G241500g [Phaseolus vulgaris] Length = 435 Score = 226 bits (575), Expect = 1e-69 Identities = 110/123 (89%), Positives = 116/123 (94%) Frame = -1 Query: 509 ASRGRVYLPQDELAQAGLSDNDIFSGKVTDKWRNFMKSQIKRARMFFDEAEKGVTELNEA 330 ASRGRVYLPQDELAQAGLSD DIF+GKVTDKWRNFMK QIKRARMFFDEAEKGVTELNEA Sbjct: 313 ASRGRVYLPQDELAQAGLSDEDIFAGKVTDKWRNFMKHQIKRARMFFDEAEKGVTELNEA 372 Query: 329 SRWPVWASLLLYRQILDEIEANDYNNFTKRAYVSKAKKLLSLPAAYARSVVPPSRKLSPV 150 SRWPVWASLLLYRQILDEIEANDYNNFT+RAYV K KK LSLP A+ARS+VPPS+ LSPV Sbjct: 373 SRWPVWASLLLYRQILDEIEANDYNNFTRRAYVGKTKKFLSLPVAFARSMVPPSKVLSPV 432 Query: 149 MKA 141 MK+ Sbjct: 433 MKS 435 >XP_019460948.1 PREDICTED: phytoene synthase 2, chloroplastic-like [Lupinus angustifolius] XP_019460949.1 PREDICTED: phytoene synthase 2, chloroplastic-like [Lupinus angustifolius] XP_019460950.1 PREDICTED: phytoene synthase 2, chloroplastic-like [Lupinus angustifolius] XP_019460951.1 PREDICTED: phytoene synthase 2, chloroplastic-like [Lupinus angustifolius] OIW02629.1 hypothetical protein TanjilG_24080 [Lupinus angustifolius] Length = 432 Score = 224 bits (572), Expect = 3e-69 Identities = 111/123 (90%), Positives = 116/123 (94%) Frame = -1 Query: 509 ASRGRVYLPQDELAQAGLSDNDIFSGKVTDKWRNFMKSQIKRARMFFDEAEKGVTELNEA 330 A+RGRVYLPQDELA AGLSD+DIF+GKVTDKWRNFMKSQIKRARMFFDEAEKGV ELNEA Sbjct: 310 ANRGRVYLPQDELALAGLSDDDIFAGKVTDKWRNFMKSQIKRARMFFDEAEKGVLELNEA 369 Query: 329 SRWPVWASLLLYRQILDEIEANDYNNFTKRAYVSKAKKLLSLPAAYARSVVPPSRKLSPV 150 SRWPVWASLLLYRQILDEIEANDYNNFTKRAYV KAKKLLSLP AYARS+VPP RK+S Sbjct: 370 SRWPVWASLLLYRQILDEIEANDYNNFTKRAYVGKAKKLLSLPIAYARSMVPPPRKVSSA 429 Query: 149 MKA 141 MKA Sbjct: 430 MKA 432 >XP_019432581.1 PREDICTED: phytoene synthase 2, chloroplastic-like [Lupinus angustifolius] XP_019432587.1 PREDICTED: phytoene synthase 2, chloroplastic-like [Lupinus angustifolius] OIW16120.1 hypothetical protein TanjilG_18835 [Lupinus angustifolius] Length = 436 Score = 223 bits (568), Expect = 1e-68 Identities = 110/123 (89%), Positives = 116/123 (94%) Frame = -1 Query: 509 ASRGRVYLPQDELAQAGLSDNDIFSGKVTDKWRNFMKSQIKRARMFFDEAEKGVTELNEA 330 A+RGRVYLPQDEL+ AGLSD+DIF+GKVTDKWR FMK QIKRARMFFDEAEKGVTELNEA Sbjct: 314 ANRGRVYLPQDELSLAGLSDDDIFAGKVTDKWRYFMKGQIKRARMFFDEAEKGVTELNEA 373 Query: 329 SRWPVWASLLLYRQILDEIEANDYNNFTKRAYVSKAKKLLSLPAAYARSVVPPSRKLSPV 150 SRWPVWASLLLYRQILDEIEANDYNNFTKRAYV KAKKLLSLP AYARS+V PSRK+SP Sbjct: 374 SRWPVWASLLLYRQILDEIEANDYNNFTKRAYVGKAKKLLSLPIAYARSMVSPSRKVSPA 433 Query: 149 MKA 141 MKA Sbjct: 434 MKA 436 >AIU48707.1 phytoene synthase, partial [Glycine max] Length = 330 Score = 216 bits (550), Expect = 4e-67 Identities = 106/111 (95%), Positives = 109/111 (98%) Frame = -1 Query: 509 ASRGRVYLPQDELAQAGLSDNDIFSGKVTDKWRNFMKSQIKRARMFFDEAEKGVTELNEA 330 ASRGRVYLPQDELAQAGLSD DIF+GKVTDKWRNFMKSQIKRARMFFDEAEKGVTELNEA Sbjct: 220 ASRGRVYLPQDELAQAGLSDEDIFAGKVTDKWRNFMKSQIKRARMFFDEAEKGVTELNEA 279 Query: 329 SRWPVWASLLLYRQILDEIEANDYNNFTKRAYVSKAKKLLSLPAAYARSVV 177 SRWPVWASLLLYRQILDEIEANDYNNFT+RAYVSKAKK LSLPAAYARS+V Sbjct: 280 SRWPVWASLLLYRQILDEIEANDYNNFTRRAYVSKAKKFLSLPAAYARSIV 330 >XP_003616147.1 squalene/phytoene synthase [Medicago truncatula] AES99105.1 squalene/phytoene synthase [Medicago truncatula] Length = 434 Score = 218 bits (555), Expect = 1e-66 Identities = 108/120 (90%), Positives = 112/120 (93%) Frame = -1 Query: 509 ASRGRVYLPQDELAQAGLSDNDIFSGKVTDKWRNFMKSQIKRARMFFDEAEKGVTELNEA 330 A RGRVYLPQDEL AGLSD+DIF+GKVTDKWRNFMKSQIKRAR FFDEAEKGVTELNE Sbjct: 315 ARRGRVYLPQDELTLAGLSDDDIFAGKVTDKWRNFMKSQIKRARTFFDEAEKGVTELNEQ 374 Query: 329 SRWPVWASLLLYRQILDEIEANDYNNFTKRAYVSKAKKLLSLPAAYARSVVPPSRKLSPV 150 SRWPVWASLLLYRQILDEIEANDYNNFTKRAYVSK KKLLSLP AYARS+VPPS+KLS V Sbjct: 375 SRWPVWASLLLYRQILDEIEANDYNNFTKRAYVSKTKKLLSLPLAYARSMVPPSKKLSHV 434 >AAX33349.1 phytoene synthase 1, partial [Prunus armeniaca] Length = 211 Score = 208 bits (530), Expect = 1e-65 Identities = 100/118 (84%), Positives = 112/118 (94%) Frame = -1 Query: 509 ASRGRVYLPQDELAQAGLSDNDIFSGKVTDKWRNFMKSQIKRARMFFDEAEKGVTELNEA 330 A RGR+YLPQDELAQAGLSD+DI++GKVTDKWR+FMK+QIKRARMFFDEAEKGVTEL+EA Sbjct: 79 ARRGRIYLPQDELAQAGLSDSDIYAGKVTDKWRSFMKNQIKRARMFFDEAEKGVTELSEA 138 Query: 329 SRWPVWASLLLYRQILDEIEANDYNNFTKRAYVSKAKKLLSLPAAYARSVVPPSRKLS 156 SRWPVWASLLLYRQILDEIEANDYNNFT+RAYVSKAKKLL+LP AY +S++ PSR S Sbjct: 139 SRWPVWASLLLYRQILDEIEANDYNNFTRRAYVSKAKKLLALPIAYTKSLIRPSRTSS 196 >ACY42670.1 phytoene synthase 2 [Manihot esculenta] Length = 429 Score = 213 bits (543), Expect = 7e-65 Identities = 105/123 (85%), Positives = 113/123 (91%) Frame = -1 Query: 509 ASRGRVYLPQDELAQAGLSDNDIFSGKVTDKWRNFMKSQIKRARMFFDEAEKGVTELNEA 330 A RGR+YLPQDELAQAGLSD+DIF+GKVTDKWRNFMK+QIKRARMFF+EAEKGVTEL+ A Sbjct: 307 ARRGRIYLPQDELAQAGLSDDDIFAGKVTDKWRNFMKNQIKRARMFFNEAEKGVTELSAA 366 Query: 329 SRWPVWASLLLYRQILDEIEANDYNNFTKRAYVSKAKKLLSLPAAYARSVVPPSRKLSPV 150 SRWPVWASLLLYR+ILDEIEANDYNNFTKRAYVSK KK+ SLP AYARS V PSR SPV Sbjct: 367 SRWPVWASLLLYRRILDEIEANDYNNFTKRAYVSKTKKIASLPIAYARSFVGPSRMSSPV 426 Query: 149 MKA 141 KA Sbjct: 427 TKA 429 >ACY42669.1 phytoene synthase 2 [Manihot esculenta] Length = 429 Score = 213 bits (543), Expect = 7e-65 Identities = 105/123 (85%), Positives = 113/123 (91%) Frame = -1 Query: 509 ASRGRVYLPQDELAQAGLSDNDIFSGKVTDKWRNFMKSQIKRARMFFDEAEKGVTELNEA 330 A RGR+YLPQDELAQAGLSD+DIF+GKVTDKWRNFMK+QIKRARMFF+EAEKGVTEL+ A Sbjct: 307 ARRGRIYLPQDELAQAGLSDDDIFAGKVTDKWRNFMKNQIKRARMFFNEAEKGVTELSAA 366 Query: 329 SRWPVWASLLLYRQILDEIEANDYNNFTKRAYVSKAKKLLSLPAAYARSVVPPSRKLSPV 150 SRWPVWASLLLYR+ILDEIEANDYNNFTKRAYVSK KK+ SLP AYARS V PSR SPV Sbjct: 367 SRWPVWASLLLYRRILDEIEANDYNNFTKRAYVSKTKKIASLPIAYARSFVGPSRMSSPV 426 Query: 149 MKA 141 KA Sbjct: 427 TKA 429 >ACY42665.1 phytoene synthase 2 [Manihot esculenta] ACY42667.1 phytoene synthase 2 [Manihot esculenta] ACY42668.1 phytoene synthase 2 [Manihot esculenta] OAY60593.1 hypothetical protein MANES_01G124200 [Manihot esculenta] Length = 429 Score = 213 bits (543), Expect = 7e-65 Identities = 105/123 (85%), Positives = 113/123 (91%) Frame = -1 Query: 509 ASRGRVYLPQDELAQAGLSDNDIFSGKVTDKWRNFMKSQIKRARMFFDEAEKGVTELNEA 330 A RGR+YLPQDELAQAGLSD+DIF+GKVTDKWRNFMK+QIKRARMFF+EAEKGVTEL+ A Sbjct: 307 ARRGRIYLPQDELAQAGLSDDDIFAGKVTDKWRNFMKNQIKRARMFFNEAEKGVTELSAA 366 Query: 329 SRWPVWASLLLYRQILDEIEANDYNNFTKRAYVSKAKKLLSLPAAYARSVVPPSRKLSPV 150 SRWPVWASLLLYR+ILDEIEANDYNNFTKRAYVSK KK+ SLP AYARS V PSR SPV Sbjct: 367 SRWPVWASLLLYRRILDEIEANDYNNFTKRAYVSKTKKIASLPIAYARSFVGPSRMSSPV 426 Query: 149 MKA 141 KA Sbjct: 427 TKA 429