BLASTX nr result
ID: Glycyrrhiza31_contig00000367
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00000367 (512 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004516996.1 PREDICTED: ATP synthase subunit delta', mitochond... 70 1e-11 GAU20258.1 hypothetical protein TSUD_353220 [Trifolium subterran... 65 7e-11 GAU20256.1 hypothetical protein TSUD_353210 [Trifolium subterran... 65 5e-10 XP_006576693.1 PREDICTED: ATP synthase subunit delta', mitochond... 64 1e-09 XP_003626769.1 F0F1-type ATP synthase, epsilon subunit [Medicago... 64 2e-09 Q41000.1 RecName: Full=ATP synthase subunit delta', mitochondria... 63 3e-09 XP_006583520.1 PREDICTED: ATP synthase subunit delta', mitochond... 63 3e-09 XP_014514999.1 PREDICTED: ATP synthase subunit delta', mitochond... 63 5e-09 XP_017442550.1 PREDICTED: ATP synthase subunit delta', mitochond... 61 2e-08 XP_010933544.1 PREDICTED: ATP synthase subunit delta', mitochond... 61 2e-08 XP_008788654.1 PREDICTED: ATP synthase subunit delta', mitochond... 61 3e-08 XP_006836816.1 PREDICTED: ATP synthase subunit delta', mitochond... 60 5e-08 XP_007134380.1 hypothetical protein PHAVU_010G042900g [Phaseolus... 60 5e-08 XP_011032008.1 PREDICTED: ATP synthase subunit delta', mitochond... 60 5e-08 XP_008786212.1 PREDICTED: ATP synthase subunit delta', mitochond... 60 7e-08 XP_009390524.1 PREDICTED: ATP synthase subunit delta', mitochond... 60 7e-08 XP_009400218.1 PREDICTED: ATP synthase subunit delta', mitochond... 60 7e-08 XP_006385594.1 hypothetical protein POPTR_0003s08430g [Populus t... 58 9e-08 XP_016174843.1 PREDICTED: ATP synthase subunit delta', mitochond... 59 1e-07 XP_015939351.1 PREDICTED: ATP synthase subunit delta', mitochond... 59 1e-07 >XP_004516996.1 PREDICTED: ATP synthase subunit delta', mitochondrial [Cicer arietinum] Length = 197 Score = 69.7 bits (169), Expect = 1e-11 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = -3 Query: 102 DVATPAVDSSFVEAWKKVSPNLDPPKTPLAFMKP 1 DVATPA DSSF+EAWKKVSPNLDPPKTP+ FMKP Sbjct: 22 DVATPAADSSFIEAWKKVSPNLDPPKTPIEFMKP 55 >GAU20258.1 hypothetical protein TSUD_353220 [Trifolium subterraneum] Length = 104 Score = 65.5 bits (158), Expect = 7e-11 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -3 Query: 102 DVATPAVDSSFVEAWKKVSPNLDPPKTPLAFMK 4 DVATPA DS+F+EAWKKVSPNLDPPKTPL F+K Sbjct: 22 DVATPAADSAFIEAWKKVSPNLDPPKTPLEFLK 54 >GAU20256.1 hypothetical protein TSUD_353210 [Trifolium subterraneum] Length = 197 Score = 65.5 bits (158), Expect = 5e-10 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = -3 Query: 102 DVATPAVDSSFVEAWKKVSPNLDPPKTPLAFMK 4 DVATPA DS+F+EAWKKVSPNLDPPKTPL F+K Sbjct: 22 DVATPAADSAFIEAWKKVSPNLDPPKTPLEFLK 54 >XP_006576693.1 PREDICTED: ATP synthase subunit delta', mitochondrial-like [Glycine max] KHN19720.1 ATP synthase subunit delta', mitochondrial [Glycine soja] KRH66417.1 hypothetical protein GLYMA_03G105300 [Glycine max] Length = 197 Score = 64.3 bits (155), Expect = 1e-09 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -3 Query: 96 ATPAVDSSFVEAWKKVSPNLDPPKTPLAFMKP 1 ATPA DS+F EAWKKVSPN+DPPKTPLA+MKP Sbjct: 24 ATPAADSAFAEAWKKVSPNIDPPKTPLAYMKP 55 >XP_003626769.1 F0F1-type ATP synthase, epsilon subunit [Medicago truncatula] AET01245.1 F0F1-type ATP synthase, epsilon subunit [Medicago truncatula] Length = 197 Score = 63.9 bits (154), Expect = 2e-09 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -3 Query: 102 DVATPAVDSSFVEAWKKVSPNLDPPKTPLAFMK 4 DVATP DSSFVEAW KVSPNLDPPKTP+AF+K Sbjct: 22 DVATPVTDSSFVEAWNKVSPNLDPPKTPVAFIK 54 >Q41000.1 RecName: Full=ATP synthase subunit delta', mitochondrial; AltName: Full=F-ATPase delta' subunit; Flags: Precursor AAA33646.1 F1-ATPase delta-prime subunit [Pisum sativum] Length = 197 Score = 63.2 bits (152), Expect = 3e-09 Identities = 27/33 (81%), Positives = 31/33 (93%) Frame = -3 Query: 102 DVATPAVDSSFVEAWKKVSPNLDPPKTPLAFMK 4 DVATPA +SSFVEAW+KVSPN+DPPKTPL F+K Sbjct: 22 DVATPATNSSFVEAWRKVSPNIDPPKTPLEFLK 54 >XP_006583520.1 PREDICTED: ATP synthase subunit delta', mitochondrial-like [Glycine max] KRH48852.1 hypothetical protein GLYMA_07G117000 [Glycine max] Length = 197 Score = 63.2 bits (152), Expect = 3e-09 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -3 Query: 96 ATPAVDSSFVEAWKKVSPNLDPPKTPLAFMKP 1 ATPA DS F EAWKKVSPN+DPPKTPLA+MKP Sbjct: 24 ATPAADSVFAEAWKKVSPNIDPPKTPLAYMKP 55 >XP_014514999.1 PREDICTED: ATP synthase subunit delta', mitochondrial [Vigna radiata var. radiata] Length = 197 Score = 62.8 bits (151), Expect = 5e-09 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -3 Query: 96 ATPAVDSSFVEAWKKVSPNLDPPKTPLAFMK 4 ATP+ DSSFVEAWKKVSPNLDPPKTPL+F+K Sbjct: 24 ATPSADSSFVEAWKKVSPNLDPPKTPLSFLK 54 >XP_017442550.1 PREDICTED: ATP synthase subunit delta', mitochondrial [Vigna angularis] BAT96877.1 hypothetical protein VIGAN_09019000 [Vigna angularis var. angularis] Length = 197 Score = 61.2 bits (147), Expect = 2e-08 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -3 Query: 96 ATPAVDSSFVEAWKKVSPNLDPPKTPLAFMK 4 ATP+ +SSFVEAWKKVSPNLDPPKTPL+F+K Sbjct: 24 ATPSAESSFVEAWKKVSPNLDPPKTPLSFLK 54 >XP_010933544.1 PREDICTED: ATP synthase subunit delta', mitochondrial-like [Elaeis guineensis] Length = 202 Score = 61.2 bits (147), Expect = 2e-08 Identities = 26/32 (81%), Positives = 29/32 (90%) Frame = -3 Query: 96 ATPAVDSSFVEAWKKVSPNLDPPKTPLAFMKP 1 A P DS+FVEAWKKV+PNLDPPKTPL+FMKP Sbjct: 29 AVPVEDSAFVEAWKKVAPNLDPPKTPLSFMKP 60 >XP_008788654.1 PREDICTED: ATP synthase subunit delta', mitochondrial-like [Phoenix dactylifera] Length = 206 Score = 60.8 bits (146), Expect = 3e-08 Identities = 25/33 (75%), Positives = 31/33 (93%) Frame = -3 Query: 99 VATPAVDSSFVEAWKKVSPNLDPPKTPLAFMKP 1 +A PA D++FVEAWKKV+PN++PPKTPLAFMKP Sbjct: 32 LAAPAEDAAFVEAWKKVAPNMEPPKTPLAFMKP 64 >XP_006836816.1 PREDICTED: ATP synthase subunit delta', mitochondrial [Amborella trichopoda] ERM99669.1 hypothetical protein AMTR_s00099p00037820 [Amborella trichopoda] Length = 195 Score = 60.1 bits (144), Expect = 5e-08 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -3 Query: 96 ATPAVDSSFVEAWKKVSPNLDPPKTPLAFMKP 1 ATP DSSFV+AW+K++PNLDPPKTPLAFM P Sbjct: 22 ATPTQDSSFVQAWQKINPNLDPPKTPLAFMTP 53 >XP_007134380.1 hypothetical protein PHAVU_010G042900g [Phaseolus vulgaris] ESW06374.1 hypothetical protein PHAVU_010G042900g [Phaseolus vulgaris] Length = 197 Score = 60.1 bits (144), Expect = 5e-08 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = -3 Query: 96 ATPAVDSSFVEAWKKVSPNLDPPKTPLAFMK 4 ATP V+SSF EAWKKVSPNL+PPKTPL+FMK Sbjct: 24 ATPVVNSSFAEAWKKVSPNLEPPKTPLSFMK 54 >XP_011032008.1 PREDICTED: ATP synthase subunit delta', mitochondrial-like [Populus euphratica] Length = 207 Score = 60.1 bits (144), Expect = 5e-08 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -3 Query: 96 ATPAVDSSFVEAWKKVSPNLDPPKTPLAFMKP 1 ATP DS+FVE+WKKV+PN+DPPKTP AFMKP Sbjct: 34 ATPVEDSAFVESWKKVAPNIDPPKTPSAFMKP 65 >XP_008786212.1 PREDICTED: ATP synthase subunit delta', mitochondrial-like [Phoenix dactylifera] Length = 202 Score = 59.7 bits (143), Expect = 7e-08 Identities = 25/32 (78%), Positives = 29/32 (90%) Frame = -3 Query: 96 ATPAVDSSFVEAWKKVSPNLDPPKTPLAFMKP 1 A P DS+FVEAWKKV+PNL+PPKTPL+FMKP Sbjct: 29 AVPVEDSAFVEAWKKVAPNLEPPKTPLSFMKP 60 >XP_009390524.1 PREDICTED: ATP synthase subunit delta', mitochondrial-like [Musa acuminata subsp. malaccensis] Length = 205 Score = 59.7 bits (143), Expect = 7e-08 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = -3 Query: 96 ATPAVDSSFVEAWKKVSPNLDPPKTPLAFMKP 1 A P+ D++FVEAW+KV+PN+DPPKTPLAFMKP Sbjct: 32 AAPSEDAAFVEAWRKVAPNIDPPKTPLAFMKP 63 >XP_009400218.1 PREDICTED: ATP synthase subunit delta', mitochondrial [Musa acuminata subsp. malaccensis] Length = 206 Score = 59.7 bits (143), Expect = 7e-08 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = -3 Query: 96 ATPAVDSSFVEAWKKVSPNLDPPKTPLAFMKP 1 A P+ D++FVEAW+KV+PN+DPPKTPLAFMKP Sbjct: 33 AAPSEDTAFVEAWRKVAPNIDPPKTPLAFMKP 64 >XP_006385594.1 hypothetical protein POPTR_0003s08430g [Populus trichocarpa] ERP63391.1 hypothetical protein POPTR_0003s08430g [Populus trichocarpa] Length = 137 Score = 58.2 bits (139), Expect = 9e-08 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = -3 Query: 93 TPAVDSSFVEAWKKVSPNLDPPKTPLAFMKP 1 TP DS+F+E+WKKV+PN+DPPKTP AFMKP Sbjct: 35 TPVQDSAFIESWKKVAPNIDPPKTPSAFMKP 65 >XP_016174843.1 PREDICTED: ATP synthase subunit delta', mitochondrial-like [Arachis ipaensis] Length = 200 Score = 59.3 bits (142), Expect = 1e-07 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -3 Query: 96 ATPAVDSSFVEAWKKVSPNLDPPKTPLAFMKP 1 A DSSFVEAWKKVSPN+DPPKTPLA+MKP Sbjct: 27 AAAVEDSSFVEAWKKVSPNVDPPKTPLAYMKP 58 >XP_015939351.1 PREDICTED: ATP synthase subunit delta', mitochondrial-like [Arachis duranensis] Length = 200 Score = 59.3 bits (142), Expect = 1e-07 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -3 Query: 96 ATPAVDSSFVEAWKKVSPNLDPPKTPLAFMKP 1 A DSSFVEAWKKVSPN+DPPKTPLA+MKP Sbjct: 27 AAAVEDSSFVEAWKKVSPNVDPPKTPLAYMKP 58