BLASTX nr result
ID: Glycyrrhiza31_contig00000314
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza31_contig00000314 (420 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP66504.1 60S ribosomal protein L13-1 [Cajanus cajan] 134 8e-37 XP_015944938.1 PREDICTED: 60S ribosomal protein L13-1 [Arachis d... 131 6e-36 XP_004499145.1 PREDICTED: 60S ribosomal protein L13-1 [Cicer ari... 131 6e-36 XP_003626150.1 60S ribosomal L13-like protein [Medicago truncatu... 131 6e-36 NP_001238240.1 uncharacterized protein LOC100499935 [Glycine max... 129 8e-36 GAU33308.1 hypothetical protein TSUD_165730 [Trifolium subterran... 130 2e-35 XP_014519879.1 PREDICTED: 60S ribosomal protein L13-1 [Vigna rad... 130 2e-35 XP_003522855.1 PREDICTED: 60S ribosomal protein L13-1 [Glycine m... 129 4e-35 GAU15831.1 hypothetical protein TSUD_236470 [Trifolium subterran... 129 5e-35 ACJ86119.1 unknown [Medicago truncatula] 129 5e-35 ACJ83987.1 unknown [Medicago truncatula] 129 5e-35 XP_013466087.1 60S ribosomal L13-like protein [Medicago truncatu... 129 5e-35 XP_006598706.1 PREDICTED: uncharacterized protein LOC100499935 i... 129 5e-35 XP_003612594.2 60S ribosomal L13-like protein [Medicago truncatu... 129 5e-35 AFK40501.1 unknown [Medicago truncatula] 129 5e-35 KYP71438.1 60S ribosomal protein L13-1 [Cajanus cajan] 129 7e-35 KHN27522.1 60S ribosomal protein L13-2 [Glycine soja] 129 7e-35 XP_004512381.1 PREDICTED: 60S ribosomal protein L13-1-like [Cice... 128 1e-34 XP_017426029.1 PREDICTED: 60S ribosomal protein L13-1 [Vigna ang... 128 1e-34 XP_016171623.1 PREDICTED: 60S ribosomal protein L13-1-like [Arac... 127 2e-34 >KYP66504.1 60S ribosomal protein L13-1 [Cajanus cajan] Length = 207 Score = 134 bits (336), Expect = 8e-37 Identities = 66/68 (97%), Positives = 68/68 (100%) Frame = +1 Query: 1 RRARKVKAGDSTPEELANATQVQGSYLPIVRERPSVELVKVTDEMKAFKAYYKLRLERTN 180 RRARKVKAGDSTPEELANATQVQGSYLPIVRE+PSVELVKVTD+MKAFKAYYKLRLERTN Sbjct: 128 RRARKVKAGDSTPEELANATQVQGSYLPIVREKPSVELVKVTDDMKAFKAYYKLRLERTN 187 Query: 181 KRHYGARL 204 KRHYGARL Sbjct: 188 KRHYGARL 195 >XP_015944938.1 PREDICTED: 60S ribosomal protein L13-1 [Arachis duranensis] XP_016180932.1 PREDICTED: 60S ribosomal protein L13-1 [Arachis ipaensis] Length = 207 Score = 131 bits (330), Expect = 6e-36 Identities = 66/68 (97%), Positives = 67/68 (98%) Frame = +1 Query: 1 RRARKVKAGDSTPEELANATQVQGSYLPIVRERPSVELVKVTDEMKAFKAYYKLRLERTN 180 RRARKVKAGDSTPEELANATQVQGS LPIVRERPSVELVKVTDEMKAFKAYYKLRLERTN Sbjct: 128 RRARKVKAGDSTPEELANATQVQGSCLPIVRERPSVELVKVTDEMKAFKAYYKLRLERTN 187 Query: 181 KRHYGARL 204 K+HYGARL Sbjct: 188 KKHYGARL 195 >XP_004499145.1 PREDICTED: 60S ribosomal protein L13-1 [Cicer arietinum] Length = 207 Score = 131 bits (330), Expect = 6e-36 Identities = 63/68 (92%), Positives = 67/68 (98%) Frame = +1 Query: 1 RRARKVKAGDSTPEELANATQVQGSYLPIVRERPSVELVKVTDEMKAFKAYYKLRLERTN 180 RRARK KAGDSTPEELANATQVQGSYLP+VRE+P+VELVK+TDEMKAFKAYYKLRLERTN Sbjct: 128 RRARKTKAGDSTPEELANATQVQGSYLPVVREKPTVELVKITDEMKAFKAYYKLRLERTN 187 Query: 181 KRHYGARL 204 KRHYGARL Sbjct: 188 KRHYGARL 195 >XP_003626150.1 60S ribosomal L13-like protein [Medicago truncatula] AES82368.1 60S ribosomal L13-like protein [Medicago truncatula] AFK42534.1 unknown [Medicago truncatula] Length = 207 Score = 131 bits (330), Expect = 6e-36 Identities = 65/68 (95%), Positives = 67/68 (98%) Frame = +1 Query: 1 RRARKVKAGDSTPEELANATQVQGSYLPIVRERPSVELVKVTDEMKAFKAYYKLRLERTN 180 RRARKVKAGDSTPEELANATQVQGSYLPIVRE+PSVELVK+TDEMKAFKAYYKLRLERTN Sbjct: 128 RRARKVKAGDSTPEELANATQVQGSYLPIVREKPSVELVKITDEMKAFKAYYKLRLERTN 187 Query: 181 KRHYGARL 204 KRH GARL Sbjct: 188 KRHLGARL 195 >NP_001238240.1 uncharacterized protein LOC100499935 [Glycine max] ACU14254.1 unknown [Glycine max] Length = 141 Score = 129 bits (324), Expect = 8e-36 Identities = 63/68 (92%), Positives = 67/68 (98%) Frame = +1 Query: 1 RRARKVKAGDSTPEELANATQVQGSYLPIVRERPSVELVKVTDEMKAFKAYYKLRLERTN 180 RRA KVKAGDSTPEELANATQVQGS+LPIVRE+P+V+LVKVTDEMKAFKAYYKLRLERTN Sbjct: 62 RRAHKVKAGDSTPEELANATQVQGSFLPIVREKPTVDLVKVTDEMKAFKAYYKLRLERTN 121 Query: 181 KRHYGARL 204 KRHYGARL Sbjct: 122 KRHYGARL 129 >GAU33308.1 hypothetical protein TSUD_165730 [Trifolium subterraneum] Length = 207 Score = 130 bits (327), Expect = 2e-35 Identities = 64/68 (94%), Positives = 67/68 (98%) Frame = +1 Query: 1 RRARKVKAGDSTPEELANATQVQGSYLPIVRERPSVELVKVTDEMKAFKAYYKLRLERTN 180 RRARKVKAGDSTPEELANATQVQGSYLPIVRE+P+VELVK+TDEMKAFKAYYKLRLERTN Sbjct: 128 RRARKVKAGDSTPEELANATQVQGSYLPIVREKPTVELVKITDEMKAFKAYYKLRLERTN 187 Query: 181 KRHYGARL 204 KRH GARL Sbjct: 188 KRHLGARL 195 >XP_014519879.1 PREDICTED: 60S ribosomal protein L13-1 [Vigna radiata var. radiata] Length = 207 Score = 130 bits (327), Expect = 2e-35 Identities = 65/68 (95%), Positives = 66/68 (97%) Frame = +1 Query: 1 RRARKVKAGDSTPEELANATQVQGSYLPIVRERPSVELVKVTDEMKAFKAYYKLRLERTN 180 RRARKVKAGDST EELANATQVQGSYLPI RE+PSVELVKVTDEMKAFKAYYKLRLERTN Sbjct: 128 RRARKVKAGDSTSEELANATQVQGSYLPIAREKPSVELVKVTDEMKAFKAYYKLRLERTN 187 Query: 181 KRHYGARL 204 KRHYGARL Sbjct: 188 KRHYGARL 195 >XP_003522855.1 PREDICTED: 60S ribosomal protein L13-1 [Glycine max] XP_006578380.1 PREDICTED: 60S ribosomal protein L13-1 [Glycine max] KHN06098.1 60S ribosomal protein L13-2 [Glycine soja] KRH62667.1 hypothetical protein GLYMA_04G122700 [Glycine max] KRH62668.1 hypothetical protein GLYMA_04G122700 [Glycine max] Length = 207 Score = 129 bits (325), Expect = 4e-35 Identities = 63/68 (92%), Positives = 68/68 (100%) Frame = +1 Query: 1 RRARKVKAGDSTPEELANATQVQGSYLPIVRERPSVELVKVTDEMKAFKAYYKLRLERTN 180 RRA+KVKAGDSTPEELANATQVQGS+LPIVRE+P+VELVKVTD+MKAFKAYYKLRLERTN Sbjct: 128 RRAQKVKAGDSTPEELANATQVQGSFLPIVREKPTVELVKVTDDMKAFKAYYKLRLERTN 187 Query: 181 KRHYGARL 204 KRHYGARL Sbjct: 188 KRHYGARL 195 >GAU15831.1 hypothetical protein TSUD_236470 [Trifolium subterraneum] Length = 207 Score = 129 bits (324), Expect = 5e-35 Identities = 63/68 (92%), Positives = 67/68 (98%) Frame = +1 Query: 1 RRARKVKAGDSTPEELANATQVQGSYLPIVRERPSVELVKVTDEMKAFKAYYKLRLERTN 180 RRARKVKAGDSTPEEL+NATQVQGSYLPIVRE+P+VELVK+TDEMKAFKAYYKLRLERTN Sbjct: 128 RRARKVKAGDSTPEELSNATQVQGSYLPIVREKPTVELVKITDEMKAFKAYYKLRLERTN 187 Query: 181 KRHYGARL 204 KRH GARL Sbjct: 188 KRHLGARL 195 >ACJ86119.1 unknown [Medicago truncatula] Length = 207 Score = 129 bits (324), Expect = 5e-35 Identities = 64/68 (94%), Positives = 66/68 (97%) Frame = +1 Query: 1 RRARKVKAGDSTPEELANATQVQGSYLPIVRERPSVELVKVTDEMKAFKAYYKLRLERTN 180 RRARK KAGDSTPEELANATQVQGSYLPIVRE+P+VELVKVTDEMKAFKAYYKLRLERTN Sbjct: 128 RRARKTKAGDSTPEELANATQVQGSYLPIVREKPTVELVKVTDEMKAFKAYYKLRLERTN 187 Query: 181 KRHYGARL 204 KRH GARL Sbjct: 188 KRHLGARL 195 >ACJ83987.1 unknown [Medicago truncatula] Length = 207 Score = 129 bits (324), Expect = 5e-35 Identities = 64/68 (94%), Positives = 66/68 (97%) Frame = +1 Query: 1 RRARKVKAGDSTPEELANATQVQGSYLPIVRERPSVELVKVTDEMKAFKAYYKLRLERTN 180 RRARK KAGDSTPEELANATQVQGSYLPIVRE+P+VELVKVTDEMKAFKAYYKLRLERTN Sbjct: 128 RRARKTKAGDSTPEELANATQVQGSYLPIVREKPTVELVKVTDEMKAFKAYYKLRLERTN 187 Query: 181 KRHYGARL 204 KRH GARL Sbjct: 188 KRHLGARL 195 >XP_013466087.1 60S ribosomal L13-like protein [Medicago truncatula] ACJ83949.1 unknown [Medicago truncatula] AFK42168.1 unknown [Medicago truncatula] KEH40126.1 60S ribosomal L13-like protein [Medicago truncatula] Length = 207 Score = 129 bits (324), Expect = 5e-35 Identities = 64/68 (94%), Positives = 66/68 (97%) Frame = +1 Query: 1 RRARKVKAGDSTPEELANATQVQGSYLPIVRERPSVELVKVTDEMKAFKAYYKLRLERTN 180 RRARK KAGDSTPEELANATQVQGSYLPIVRE+P+VELVKVTDEMKAFKAYYKLRLERTN Sbjct: 128 RRARKTKAGDSTPEELANATQVQGSYLPIVREKPTVELVKVTDEMKAFKAYYKLRLERTN 187 Query: 181 KRHYGARL 204 KRH GARL Sbjct: 188 KRHLGARL 195 >XP_006598706.1 PREDICTED: uncharacterized protein LOC100499935 isoform X1 [Glycine max] KRH07204.1 hypothetical protein GLYMA_16G074600 [Glycine max] Length = 207 Score = 129 bits (324), Expect = 5e-35 Identities = 63/68 (92%), Positives = 67/68 (98%) Frame = +1 Query: 1 RRARKVKAGDSTPEELANATQVQGSYLPIVRERPSVELVKVTDEMKAFKAYYKLRLERTN 180 RRA KVKAGDSTPEELANATQVQGS+LPIVRE+P+V+LVKVTDEMKAFKAYYKLRLERTN Sbjct: 128 RRAHKVKAGDSTPEELANATQVQGSFLPIVREKPTVDLVKVTDEMKAFKAYYKLRLERTN 187 Query: 181 KRHYGARL 204 KRHYGARL Sbjct: 188 KRHYGARL 195 >XP_003612594.2 60S ribosomal L13-like protein [Medicago truncatula] AFK45847.1 unknown [Medicago truncatula] AES95552.2 60S ribosomal L13-like protein [Medicago truncatula] Length = 207 Score = 129 bits (324), Expect = 5e-35 Identities = 64/68 (94%), Positives = 66/68 (97%) Frame = +1 Query: 1 RRARKVKAGDSTPEELANATQVQGSYLPIVRERPSVELVKVTDEMKAFKAYYKLRLERTN 180 RRARKVKAGDSTPEELANATQVQGSYLPIV E+PSVELVK+TDEMKAFKAYYKLRLERTN Sbjct: 128 RRARKVKAGDSTPEELANATQVQGSYLPIVSEKPSVELVKITDEMKAFKAYYKLRLERTN 187 Query: 181 KRHYGARL 204 KRH GARL Sbjct: 188 KRHLGARL 195 >AFK40501.1 unknown [Medicago truncatula] Length = 207 Score = 129 bits (324), Expect = 5e-35 Identities = 64/68 (94%), Positives = 66/68 (97%) Frame = +1 Query: 1 RRARKVKAGDSTPEELANATQVQGSYLPIVRERPSVELVKVTDEMKAFKAYYKLRLERTN 180 RRARKVKAGDSTPEELANATQVQGSYLPIV E+PSVELVK+TDEMKAFKAYYKLRLERTN Sbjct: 128 RRARKVKAGDSTPEELANATQVQGSYLPIVSEKPSVELVKITDEMKAFKAYYKLRLERTN 187 Query: 181 KRHYGARL 204 KRH GARL Sbjct: 188 KRHLGARL 195 >KYP71438.1 60S ribosomal protein L13-1 [Cajanus cajan] Length = 207 Score = 129 bits (323), Expect = 7e-35 Identities = 63/68 (92%), Positives = 67/68 (98%) Frame = +1 Query: 1 RRARKVKAGDSTPEELANATQVQGSYLPIVRERPSVELVKVTDEMKAFKAYYKLRLERTN 180 RRARKVKAGDS+PEELANATQVQG +LPIVRE+PSV+LVKVTDEMKAFKAYYKLRLERTN Sbjct: 128 RRARKVKAGDSSPEELANATQVQGPFLPIVREKPSVDLVKVTDEMKAFKAYYKLRLERTN 187 Query: 181 KRHYGARL 204 KRHYGARL Sbjct: 188 KRHYGARL 195 >KHN27522.1 60S ribosomal protein L13-2 [Glycine soja] Length = 207 Score = 129 bits (323), Expect = 7e-35 Identities = 62/68 (91%), Positives = 67/68 (98%) Frame = +1 Query: 1 RRARKVKAGDSTPEELANATQVQGSYLPIVRERPSVELVKVTDEMKAFKAYYKLRLERTN 180 RRA KVKAGDSTPEELANATQVQGS+LPIVRE+P+V+L+KVTDEMKAFKAYYKLRLERTN Sbjct: 128 RRAHKVKAGDSTPEELANATQVQGSFLPIVREKPTVDLIKVTDEMKAFKAYYKLRLERTN 187 Query: 181 KRHYGARL 204 KRHYGARL Sbjct: 188 KRHYGARL 195 >XP_004512381.1 PREDICTED: 60S ribosomal protein L13-1-like [Cicer arietinum] Length = 207 Score = 128 bits (322), Expect = 1e-34 Identities = 63/68 (92%), Positives = 65/68 (95%) Frame = +1 Query: 1 RRARKVKAGDSTPEELANATQVQGSYLPIVRERPSVELVKVTDEMKAFKAYYKLRLERTN 180 RRA KVKAGDSTPEELANATQV GSYLP VRE+PSVELVK+TDEMKAFKAYYKLRLERTN Sbjct: 128 RRAHKVKAGDSTPEELANATQVTGSYLPTVREKPSVELVKITDEMKAFKAYYKLRLERTN 187 Query: 181 KRHYGARL 204 KRHYGARL Sbjct: 188 KRHYGARL 195 >XP_017426029.1 PREDICTED: 60S ribosomal protein L13-1 [Vigna angularis] KOM45421.1 hypothetical protein LR48_Vigan06g072700 [Vigna angularis] BAT99753.1 hypothetical protein VIGAN_10126500 [Vigna angularis var. angularis] Length = 207 Score = 128 bits (321), Expect = 1e-34 Identities = 63/68 (92%), Positives = 66/68 (97%) Frame = +1 Query: 1 RRARKVKAGDSTPEELANATQVQGSYLPIVRERPSVELVKVTDEMKAFKAYYKLRLERTN 180 RRARKVKAGDST EELANATQVQGSYLPI RE+P+VELVKVTD+MKAFKAYYKLRLERTN Sbjct: 128 RRARKVKAGDSTSEELANATQVQGSYLPIAREKPAVELVKVTDDMKAFKAYYKLRLERTN 187 Query: 181 KRHYGARL 204 KRHYGARL Sbjct: 188 KRHYGARL 195 >XP_016171623.1 PREDICTED: 60S ribosomal protein L13-1-like [Arachis ipaensis] Length = 207 Score = 127 bits (320), Expect = 2e-34 Identities = 62/68 (91%), Positives = 67/68 (98%) Frame = +1 Query: 1 RRARKVKAGDSTPEELANATQVQGSYLPIVRERPSVELVKVTDEMKAFKAYYKLRLERTN 180 RRA+KVKAGDST EELANATQVQGSY+PI+RE+PSVELVKVTDEMKAFKAYYKLRLERTN Sbjct: 128 RRAKKVKAGDSTAEELANATQVQGSYMPILREKPSVELVKVTDEMKAFKAYYKLRLERTN 187 Query: 181 KRHYGARL 204 K+HYGARL Sbjct: 188 KKHYGARL 195