BLASTX nr result
ID: Glycyrrhiza30_contig00041430
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00041430 (277 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007142311.1 hypothetical protein PHAVU_008G270000g [Phaseolus... 54 3e-06 >XP_007142311.1 hypothetical protein PHAVU_008G270000g [Phaseolus vulgaris] ESW14305.1 hypothetical protein PHAVU_008G270000g [Phaseolus vulgaris] Length = 416 Score = 53.5 bits (127), Expect = 3e-06 Identities = 26/54 (48%), Positives = 35/54 (64%) Frame = +3 Query: 3 YIGILSLLGAIAFGLEIYTWIKFFRSKSKQLNSQGKGTETQQANKDKSSDNNAV 164 YIG L+ LGAIAFGLE+YTWI+FF K KQ N +T+Q +++ N + Sbjct: 362 YIGNLAFLGAIAFGLEVYTWIRFFMLKQKQ-NQNKNQNQTEQIQEEQPPKLNII 414