BLASTX nr result
ID: Glycyrrhiza30_contig00040501
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00040501 (305 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHN23036.1 Lectin-domain containing receptor kinase VI.3 [Glycin... 74 2e-13 KRH49436.1 hypothetical protein GLYMA_07G154100 [Glycine max] 74 2e-13 XP_003530300.2 PREDICTED: lectin-domain containing receptor kina... 74 2e-13 XP_007134605.1 hypothetical protein PHAVU_010G060800g [Phaseolus... 73 5e-13 KYP46087.1 Lectin-domain containing receptor kinase A4.2 [Cajanu... 73 7e-13 KHN40717.1 Lectin-domain containing receptor kinase VI.3 [Glycin... 73 7e-13 XP_003551569.1 PREDICTED: lectin-domain containing receptor kina... 73 7e-13 XP_007140223.1 hypothetical protein PHAVU_008G094500g [Phaseolus... 72 1e-12 KYP37366.1 Lectin-domain containing receptor kinase A4.3 [Cajanu... 71 2e-12 KHN28870.1 Lectin-domain containing receptor kinase VI.3 [Glycin... 71 3e-12 XP_003522051.1 PREDICTED: probable L-type lectin-domain containi... 71 3e-12 XP_014511779.1 PREDICTED: lectin-domain containing receptor kina... 68 4e-11 XP_017441764.1 PREDICTED: lectin-domain containing receptor kina... 67 6e-11 KOM37444.1 hypothetical protein LR48_Vigan03g082600 [Vigna angul... 67 6e-11 XP_014490660.1 PREDICTED: lectin-domain containing receptor kina... 67 6e-11 XP_017416504.1 PREDICTED: lectin-domain containing receptor kina... 67 6e-11 GAV73593.1 Pkinase domain-containing protein/Lectin_legB domain-... 64 9e-10 XP_019429697.1 PREDICTED: probable L-type lectin-domain containi... 64 9e-10 XP_019076992.1 PREDICTED: lectin-domain containing receptor kina... 55 2e-06 XP_010653406.1 PREDICTED: lectin-domain containing receptor kina... 55 2e-06 >KHN23036.1 Lectin-domain containing receptor kinase VI.3 [Glycine soja] Length = 625 Score = 74.3 bits (181), Expect = 2e-13 Identities = 34/40 (85%), Positives = 37/40 (92%), Gaps = 1/40 (2%) Frame = -3 Query: 303 VLKLGLLCTQDKADYRPTMKQVTRYLNFDDPLP-VVDWRH 187 VLKLGLLCTQ +ADYRPTMKQVTRYLNFD+PLP +VDW H Sbjct: 539 VLKLGLLCTQHRADYRPTMKQVTRYLNFDEPLPDIVDWGH 578 >KRH49436.1 hypothetical protein GLYMA_07G154100 [Glycine max] Length = 681 Score = 74.3 bits (181), Expect = 2e-13 Identities = 34/40 (85%), Positives = 37/40 (92%), Gaps = 1/40 (2%) Frame = -3 Query: 303 VLKLGLLCTQDKADYRPTMKQVTRYLNFDDPLP-VVDWRH 187 VLKLGLLCTQ +ADYRPTMKQVTRYLNFD+PLP +VDW H Sbjct: 595 VLKLGLLCTQHRADYRPTMKQVTRYLNFDEPLPDIVDWGH 634 >XP_003530300.2 PREDICTED: lectin-domain containing receptor kinase VI.3-like [Glycine max] Length = 696 Score = 74.3 bits (181), Expect = 2e-13 Identities = 34/40 (85%), Positives = 37/40 (92%), Gaps = 1/40 (2%) Frame = -3 Query: 303 VLKLGLLCTQDKADYRPTMKQVTRYLNFDDPLP-VVDWRH 187 VLKLGLLCTQ +ADYRPTMKQVTRYLNFD+PLP +VDW H Sbjct: 610 VLKLGLLCTQHRADYRPTMKQVTRYLNFDEPLPDIVDWGH 649 >XP_007134605.1 hypothetical protein PHAVU_010G060800g [Phaseolus vulgaris] ESW06599.1 hypothetical protein PHAVU_010G060800g [Phaseolus vulgaris] Length = 662 Score = 73.2 bits (178), Expect = 5e-13 Identities = 32/42 (76%), Positives = 39/42 (92%), Gaps = 1/42 (2%) Frame = -3 Query: 303 VLKLGLLCTQDKADYRPTMKQVTRYLNFDDPLP-VVDWRHYD 181 VLKLGLLCTQ+KA+YRP+++QVTRYLNFDDP P + DWR+YD Sbjct: 588 VLKLGLLCTQNKAEYRPSIEQVTRYLNFDDPFPDISDWRYYD 629 >KYP46087.1 Lectin-domain containing receptor kinase A4.2 [Cajanus cajan] Length = 499 Score = 72.8 bits (177), Expect = 7e-13 Identities = 38/57 (66%), Positives = 42/57 (73%), Gaps = 1/57 (1%) Frame = -3 Query: 303 VLKLGLLCTQDKADYRPTMKQVTRYLNFDDPLP-VVDWRHYDXXXXXXXXXSFLEAM 136 VLKLGLLCTQ KAD+RP+MKQ+TRYLNFDDPLP +WRH D FLEAM Sbjct: 419 VLKLGLLCTQHKADHRPSMKQLTRYLNFDDPLPHTSEWRHCD-SQSSTTSFGFLEAM 474 >KHN40717.1 Lectin-domain containing receptor kinase VI.3 [Glycine soja] Length = 683 Score = 72.8 bits (177), Expect = 7e-13 Identities = 33/40 (82%), Positives = 36/40 (90%), Gaps = 1/40 (2%) Frame = -3 Query: 303 VLKLGLLCTQDKADYRPTMKQVTRYLNFDDPLP-VVDWRH 187 VLKLGLLCTQ +ADYRP+MKQVTRYLNFDDPLP + DW H Sbjct: 602 VLKLGLLCTQHRADYRPSMKQVTRYLNFDDPLPDIADWGH 641 >XP_003551569.1 PREDICTED: lectin-domain containing receptor kinase VI.3-like [Glycine max] KRH00306.1 hypothetical protein GLYMA_18G205000 [Glycine max] Length = 683 Score = 72.8 bits (177), Expect = 7e-13 Identities = 33/40 (82%), Positives = 36/40 (90%), Gaps = 1/40 (2%) Frame = -3 Query: 303 VLKLGLLCTQDKADYRPTMKQVTRYLNFDDPLP-VVDWRH 187 VLKLGLLCTQ +ADYRP+MKQVTRYLNFDDPLP + DW H Sbjct: 602 VLKLGLLCTQHRADYRPSMKQVTRYLNFDDPLPDIADWGH 641 >XP_007140223.1 hypothetical protein PHAVU_008G094500g [Phaseolus vulgaris] ESW12217.1 hypothetical protein PHAVU_008G094500g [Phaseolus vulgaris] Length = 673 Score = 72.4 bits (176), Expect = 1e-12 Identities = 35/55 (63%), Positives = 38/55 (69%), Gaps = 1/55 (1%) Frame = -3 Query: 303 VLKLGLLCTQDKADYRPTMKQVTRYLNFDDPLP-VVDWRHYDXXXXXXXXXSFLE 142 VLKLGLLC+Q + DYRPTMKQVTRYLNFDDPLP DW H+ FLE Sbjct: 591 VLKLGLLCSQHRPDYRPTMKQVTRYLNFDDPLPDTADWGHFGSNSSSRMNSGFLE 645 >KYP37366.1 Lectin-domain containing receptor kinase A4.3 [Cajanus cajan] Length = 505 Score = 71.2 bits (173), Expect = 2e-12 Identities = 33/38 (86%), Positives = 35/38 (92%), Gaps = 1/38 (2%) Frame = -3 Query: 303 VLKLGLLCTQDKADYRPTMKQVTRYLNFDDPLPVV-DW 193 VLKLGLLCTQ +ADYRPTMKQVTRYLNFDDPLP + DW Sbjct: 423 VLKLGLLCTQHRADYRPTMKQVTRYLNFDDPLPEIGDW 460 >KHN28870.1 Lectin-domain containing receptor kinase VI.3 [Glycine soja] Length = 677 Score = 70.9 bits (172), Expect = 3e-12 Identities = 38/57 (66%), Positives = 43/57 (75%), Gaps = 1/57 (1%) Frame = -3 Query: 303 VLKLGLLCTQDKADYRPTMKQVTRYLNFDDPLP-VVDWRHYDXXXXXXXXXSFLEAM 136 VLKLGLLC+Q KA+YRP+MKQV RYLNFDD LP + DWR+YD SFLEAM Sbjct: 596 VLKLGLLCSQYKAEYRPSMKQVARYLNFDDSLPDISDWRYYD-SQSSTNSLSFLEAM 651 >XP_003522051.1 PREDICTED: probable L-type lectin-domain containing receptor kinase VI.1 [Glycine max] KRH65635.1 hypothetical protein GLYMA_03G051100 [Glycine max] Length = 677 Score = 70.9 bits (172), Expect = 3e-12 Identities = 38/57 (66%), Positives = 43/57 (75%), Gaps = 1/57 (1%) Frame = -3 Query: 303 VLKLGLLCTQDKADYRPTMKQVTRYLNFDDPLP-VVDWRHYDXXXXXXXXXSFLEAM 136 VLKLGLLC+Q KA+YRP+MKQV RYLNFDD LP + DWR+YD SFLEAM Sbjct: 596 VLKLGLLCSQYKAEYRPSMKQVARYLNFDDSLPDISDWRYYD-SQSSTNSLSFLEAM 651 >XP_014511779.1 PREDICTED: lectin-domain containing receptor kinase VI.4-like [Vigna radiata var. radiata] Length = 668 Score = 67.8 bits (164), Expect = 4e-11 Identities = 35/57 (61%), Positives = 43/57 (75%), Gaps = 1/57 (1%) Frame = -3 Query: 303 VLKLGLLCTQDKADYRPTMKQVTRYLNFDDPLP-VVDWRHYDXXXXXXXXXSFLEAM 136 VLKLGLLC+Q+KA+YRP+++QVTRYLNFDDP P + D R+YD FLEAM Sbjct: 588 VLKLGLLCSQNKAEYRPSIEQVTRYLNFDDPFPDISDCRYYD-SQSSTTSLGFLEAM 643 >XP_017441764.1 PREDICTED: lectin-domain containing receptor kinase VI.4-like [Vigna angularis] KOM58011.1 hypothetical protein LR48_Vigan11g104400 [Vigna angularis] BAT97457.1 hypothetical protein VIGAN_09090500 [Vigna angularis var. angularis] Length = 667 Score = 67.4 bits (163), Expect = 6e-11 Identities = 35/57 (61%), Positives = 42/57 (73%), Gaps = 1/57 (1%) Frame = -3 Query: 303 VLKLGLLCTQDKADYRPTMKQVTRYLNFDDPLP-VVDWRHYDXXXXXXXXXSFLEAM 136 VLKLGLLC Q+KA+YRP+++QVTRYLNFDDP P + D R+YD FLEAM Sbjct: 587 VLKLGLLCAQNKAEYRPSIEQVTRYLNFDDPFPDISDCRYYD-SQSSTTSLGFLEAM 642 >KOM37444.1 hypothetical protein LR48_Vigan03g082600 [Vigna angularis] BAT84050.1 hypothetical protein VIGAN_04131800 [Vigna angularis var. angularis] Length = 677 Score = 67.4 bits (163), Expect = 6e-11 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -3 Query: 303 VLKLGLLCTQDKADYRPTMKQVTRYLNFDDPLP 205 VLKLGLLCTQ ++DYRPTMKQVTRYLNFDDPLP Sbjct: 595 VLKLGLLCTQRRSDYRPTMKQVTRYLNFDDPLP 627 >XP_014490660.1 PREDICTED: lectin-domain containing receptor kinase VI.3-like [Vigna radiata var. radiata] Length = 683 Score = 67.4 bits (163), Expect = 6e-11 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -3 Query: 303 VLKLGLLCTQDKADYRPTMKQVTRYLNFDDPLP 205 VLKLGLLCTQ ++DYRPTMKQVTRYLNFDDPLP Sbjct: 599 VLKLGLLCTQRRSDYRPTMKQVTRYLNFDDPLP 631 >XP_017416504.1 PREDICTED: lectin-domain containing receptor kinase VI.3-like [Vigna angularis] Length = 697 Score = 67.4 bits (163), Expect = 6e-11 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = -3 Query: 303 VLKLGLLCTQDKADYRPTMKQVTRYLNFDDPLP 205 VLKLGLLCTQ ++DYRPTMKQVTRYLNFDDPLP Sbjct: 615 VLKLGLLCTQRRSDYRPTMKQVTRYLNFDDPLP 647 >GAV73593.1 Pkinase domain-containing protein/Lectin_legB domain-containing protein [Cephalotus follicularis] Length = 674 Score = 63.9 bits (154), Expect = 9e-10 Identities = 32/57 (56%), Positives = 37/57 (64%), Gaps = 1/57 (1%) Frame = -3 Query: 303 VLKLGLLCTQDKADYRPTMKQVTRYLNFDDPLPVVD-WRHYDXXXXXXXXXSFLEAM 136 VLKLGLLC+ K + RPTM+QV RYLN DDPLPVVD W +D FLE + Sbjct: 593 VLKLGLLCSHQKPEVRPTMRQVVRYLNGDDPLPVVDNWSSFDSSQSSEMRSRFLEVI 649 >XP_019429697.1 PREDICTED: probable L-type lectin-domain containing receptor kinase VI.1 [Lupinus angustifolius] OIW19144.1 hypothetical protein TanjilG_10325 [Lupinus angustifolius] Length = 683 Score = 63.9 bits (154), Expect = 9e-10 Identities = 29/40 (72%), Positives = 33/40 (82%), Gaps = 1/40 (2%) Frame = -3 Query: 303 VLKLGLLCTQDKADYRPTMKQVTRYLNFDDPLP-VVDWRH 187 VLKLGLLC +ADYRPTMK+VTRYLNFD+ LP + DW H Sbjct: 603 VLKLGLLCCHHRADYRPTMKEVTRYLNFDELLPSIADWTH 642 >XP_019076992.1 PREDICTED: lectin-domain containing receptor kinase VI.3-like isoform X2 [Vitis vinifera] Length = 713 Score = 54.7 bits (130), Expect = 2e-06 Identities = 27/55 (49%), Positives = 35/55 (63%), Gaps = 1/55 (1%) Frame = -3 Query: 303 VLKLGLLCTQDKADYRPTMKQVTRYLNFDDPLPVV-DWRHYDXXXXXXXXXSFLE 142 VL+LGL C+ + + RPTM+QVTRYL+ DDPLP+V DW D FL+ Sbjct: 631 VLRLGLFCSHPRPEARPTMRQVTRYLSRDDPLPIVDDWAAPDSSRFSDISPRFLQ 685 >XP_010653406.1 PREDICTED: lectin-domain containing receptor kinase VI.3-like isoform X1 [Vitis vinifera] Length = 723 Score = 54.7 bits (130), Expect = 2e-06 Identities = 27/55 (49%), Positives = 35/55 (63%), Gaps = 1/55 (1%) Frame = -3 Query: 303 VLKLGLLCTQDKADYRPTMKQVTRYLNFDDPLPVV-DWRHYDXXXXXXXXXSFLE 142 VL+LGL C+ + + RPTM+QVTRYL+ DDPLP+V DW D FL+ Sbjct: 641 VLRLGLFCSHPRPEARPTMRQVTRYLSRDDPLPIVDDWAAPDSSRFSDISPRFLQ 695