BLASTX nr result
ID: Glycyrrhiza30_contig00040290
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00040290 (325 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU46121.1 hypothetical protein TSUD_192820 [Trifolium subterran... 45 1e-06 >GAU46121.1 hypothetical protein TSUD_192820 [Trifolium subterraneum] Length = 488 Score = 44.7 bits (104), Expect(2) = 1e-06 Identities = 21/30 (70%), Positives = 24/30 (80%) Frame = +1 Query: 160 LNSAWKRCWLSNMST*KFQLSSISLYSTLQ 249 L+SA+KRCW N S KFQL S+SLYSTLQ Sbjct: 2 LSSAFKRCWPQNTSAIKFQLISVSLYSTLQ 31 Score = 35.0 bits (79), Expect(2) = 1e-06 Identities = 15/23 (65%), Positives = 19/23 (82%) Frame = +3 Query: 246 ANLEPIFAPP*FQELCNIVTTTV 314 + L+PI APP Q+LCNIVT+TV Sbjct: 28 STLQPISAPPQLQDLCNIVTSTV 50