BLASTX nr result
ID: Glycyrrhiza30_contig00040070
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00040070 (176 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007141826.1 hypothetical protein PHAVU_008G228900g [Phaseolus... 52 3e-06 XP_016166969.1 PREDICTED: cucumisin-like [Arachis ipaensis] 52 4e-06 XP_015931432.1 PREDICTED: cucumisin-like [Arachis duranensis] 52 4e-06 >XP_007141826.1 hypothetical protein PHAVU_008G228900g [Phaseolus vulgaris] ESW13820.1 hypothetical protein PHAVU_008G228900g [Phaseolus vulgaris] Length = 649 Score = 52.0 bits (123), Expect = 3e-06 Identities = 29/56 (51%), Positives = 32/56 (57%) Frame = +3 Query: 3 VPSARIAVYKVLWESIGATEVXXXXXXXXXXXXGVDVISLSIGWDPTTPALKYFED 170 VPSARIAVYKV WES G V GVD+IS+S+G LKYFED Sbjct: 228 VPSARIAVYKVCWES-GCNGVDILAGVDAAIADGVDIISISVGEKEVVQQLKYFED 282 >XP_016166969.1 PREDICTED: cucumisin-like [Arachis ipaensis] Length = 752 Score = 51.6 bits (122), Expect = 4e-06 Identities = 28/57 (49%), Positives = 32/57 (56%) Frame = +3 Query: 6 PSARIAVYKVLWESIGATEVXXXXXXXXXXXXGVDVISLSIGWDPTTPALKYFEDAI 176 PSARIA+YKV W S G + GVDVIS+S+G D P YFEDAI Sbjct: 237 PSARIAIYKVCWSSDGCDDANVLAAFDDAIHDGVDVISISVGADVAFP-FSYFEDAI 292 >XP_015931432.1 PREDICTED: cucumisin-like [Arachis duranensis] Length = 752 Score = 51.6 bits (122), Expect = 4e-06 Identities = 28/57 (49%), Positives = 32/57 (56%) Frame = +3 Query: 6 PSARIAVYKVLWESIGATEVXXXXXXXXXXXXGVDVISLSIGWDPTTPALKYFEDAI 176 PSARIA+YKV W S G + GVDVIS+S+G D P YFEDAI Sbjct: 237 PSARIAIYKVCWSSNGCDDANVLAAFDDAIHDGVDVISISVGADVAFP-FSYFEDAI 292