BLASTX nr result
ID: Glycyrrhiza30_contig00039694
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00039694 (282 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019442473.1 PREDICTED: transcription repressor OFP6-like [Lup... 78 5e-16 GAU17474.1 hypothetical protein TSUD_340170 [Trifolium subterran... 78 1e-15 XP_019429216.1 PREDICTED: transcription repressor OFP6-like [Lup... 77 1e-15 XP_004494234.1 PREDICTED: transcription repressor OFP6 [Cicer ar... 76 3e-15 XP_013441486.1 ovate transcriptional repressor [Medicago truncat... 74 1e-14 XP_019456272.1 PREDICTED: transcription repressor OFP6-like [Lup... 73 4e-14 XP_013450173.1 ovate transcriptional repressor [Medicago truncat... 74 4e-14 XP_019432593.1 PREDICTED: transcription repressor OFP6-like [Lup... 72 2e-13 XP_014626917.1 PREDICTED: transcription repressor OFP6-like isof... 71 5e-13 XP_014626916.1 PREDICTED: transcription repressor OFP6-like isof... 71 5e-13 XP_015970618.1 PREDICTED: transcription repressor OFP6-like [Ara... 70 1e-12 XP_016207706.1 PREDICTED: transcription repressor OFP6 [Arachis ... 70 1e-12 XP_004497705.1 PREDICTED: transcription repressor OFP6 [Cicer ar... 69 1e-12 XP_003519129.2 PREDICTED: transcription repressor OFP6-like [Gly... 69 2e-12 KHN33168.1 hypothetical protein glysoja_039484 [Glycine soja] 69 2e-12 KHN02184.1 hypothetical protein glysoja_002208 [Glycine soja] KR... 69 2e-12 XP_003535805.1 PREDICTED: transcription repressor OFP6-like [Gly... 68 3e-12 XP_017417726.1 PREDICTED: transcription repressor OFP6-like [Vig... 68 4e-12 BAT85910.1 hypothetical protein VIGAN_04350900 [Vigna angularis ... 68 4e-12 KOM39088.1 hypothetical protein LR48_Vigan03g247000 [Vigna angul... 68 5e-12 >XP_019442473.1 PREDICTED: transcription repressor OFP6-like [Lupinus angustifolius] OIW11373.1 hypothetical protein TanjilG_19629 [Lupinus angustifolius] Length = 181 Score = 78.2 bits (191), Expect = 5e-16 Identities = 35/49 (71%), Positives = 44/49 (89%) Frame = +1 Query: 136 MSSSRRKVILNSVSVKLGCGTCRRPKLIGFLFHTKPKPKNPTYQKHKLY 282 MS+SR+K++LN+VSVKLGCG+CRRPKL +FH KPKP+NPTY K+KLY Sbjct: 1 MSTSRKKLLLNTVSVKLGCGSCRRPKLSN-IFHPKPKPQNPTYSKNKLY 48 >GAU17474.1 hypothetical protein TSUD_340170 [Trifolium subterraneum] Length = 200 Score = 77.8 bits (190), Expect = 1e-15 Identities = 36/49 (73%), Positives = 44/49 (89%) Frame = +1 Query: 136 MSSSRRKVILNSVSVKLGCGTCRRPKLIGFLFHTKPKPKNPTYQKHKLY 282 MSSSR+K++LN+VSVKLGCG+CR+ KL +F+ KPKPKNPTYQKHKLY Sbjct: 1 MSSSRKKLLLNTVSVKLGCGSCRKLKLSN-IFNPKPKPKNPTYQKHKLY 48 >XP_019429216.1 PREDICTED: transcription repressor OFP6-like [Lupinus angustifolius] OIW16540.1 hypothetical protein TanjilG_00049 [Lupinus angustifolius] Length = 176 Score = 77.0 bits (188), Expect = 1e-15 Identities = 35/48 (72%), Positives = 43/48 (89%) Frame = +1 Query: 136 MSSSRRKVILNSVSVKLGCGTCRRPKLIGFLFHTKPKPKNPTYQKHKL 279 MSSSRRK++LN+VSV +GCG+CRRPKL+ +F+TKPKPK TYQKHKL Sbjct: 1 MSSSRRKLVLNTVSVNIGCGSCRRPKLL-HIFNTKPKPKKSTYQKHKL 47 >XP_004494234.1 PREDICTED: transcription repressor OFP6 [Cicer arietinum] Length = 194 Score = 76.3 bits (186), Expect = 3e-15 Identities = 35/49 (71%), Positives = 42/49 (85%) Frame = +1 Query: 136 MSSSRRKVILNSVSVKLGCGTCRRPKLIGFLFHTKPKPKNPTYQKHKLY 282 MS SR+K++LN+VSVKLGCG+CRR KL +FH KPKP+N TYQKHKLY Sbjct: 1 MSGSRKKLLLNTVSVKLGCGSCRRLKL-SHIFHPKPKPRNSTYQKHKLY 48 >XP_013441486.1 ovate transcriptional repressor [Medicago truncatula] KEH15511.1 ovate transcriptional repressor [Medicago truncatula] Length = 182 Score = 74.3 bits (181), Expect = 1e-14 Identities = 33/47 (70%), Positives = 41/47 (87%) Frame = +1 Query: 136 MSSSRRKVILNSVSVKLGCGTCRRPKLIGFLFHTKPKPKNPTYQKHK 276 MS+S++K+ LN+VS+ LGCGTC RPKL GF+F+TKPK KNPTYQ HK Sbjct: 1 MSTSKKKLTLNTVSINLGCGTCTRPKL-GFIFNTKPKHKNPTYQNHK 46 >XP_019456272.1 PREDICTED: transcription repressor OFP6-like [Lupinus angustifolius] OIW05162.1 hypothetical protein TanjilG_19793 [Lupinus angustifolius] Length = 162 Score = 72.8 bits (177), Expect = 4e-14 Identities = 33/49 (67%), Positives = 40/49 (81%) Frame = +1 Query: 136 MSSSRRKVILNSVSVKLGCGTCRRPKLIGFLFHTKPKPKNPTYQKHKLY 282 MSSSR+K+ILN+VS+ LGCG+C RP L +FH KP PKNPTY K+KLY Sbjct: 1 MSSSRKKLILNTVSMNLGCGSCTRPNL-SHIFHPKPNPKNPTYSKNKLY 48 >XP_013450173.1 ovate transcriptional repressor [Medicago truncatula] KEH24201.1 ovate transcriptional repressor [Medicago truncatula] Length = 199 Score = 73.6 bits (179), Expect = 4e-14 Identities = 35/49 (71%), Positives = 41/49 (83%) Frame = +1 Query: 136 MSSSRRKVILNSVSVKLGCGTCRRPKLIGFLFHTKPKPKNPTYQKHKLY 282 MS SR+K++LN+VSVKLGCG+CRR KL +F KPK KNPTYQKHKLY Sbjct: 1 MSGSRKKLLLNTVSVKLGCGSCRRLKLSN-IFSPKPKSKNPTYQKHKLY 48 >XP_019432593.1 PREDICTED: transcription repressor OFP6-like [Lupinus angustifolius] XP_019416276.1 PREDICTED: transcription repressor OFP6-like [Lupinus angustifolius] OIW21240.1 hypothetical protein TanjilG_31112 [Lupinus angustifolius] Length = 184 Score = 71.6 bits (174), Expect = 2e-13 Identities = 34/49 (69%), Positives = 41/49 (83%) Frame = +1 Query: 136 MSSSRRKVILNSVSVKLGCGTCRRPKLIGFLFHTKPKPKNPTYQKHKLY 282 MSSSR+K++LN VSVKL CG+CRR KL +F+ KPKPKNPTY K+KLY Sbjct: 1 MSSSRKKLLLNKVSVKLDCGSCRRLKL-SHIFNPKPKPKNPTYSKNKLY 48 >XP_014626917.1 PREDICTED: transcription repressor OFP6-like isoform X2 [Glycine max] Length = 224 Score = 71.2 bits (173), Expect = 5e-13 Identities = 38/62 (61%), Positives = 45/62 (72%), Gaps = 2/62 (3%) Frame = +1 Query: 97 THRNRTLKTEHNKMSSSRRKVILNSVSVKLGCGTCRRPKLIGFLFHTKPKPK--NPTYQK 270 TH N T+ MS SR+K++LN+VSVKLGCGTCRRP L +FH KPKPK N TY+K Sbjct: 5 THGN----TDTTAMSGSRKKLLLNTVSVKLGCGTCRRPNLCR-IFHPKPKPKNLNNTYRK 59 Query: 271 HK 276 HK Sbjct: 60 HK 61 >XP_014626916.1 PREDICTED: transcription repressor OFP6-like isoform X1 [Glycine max] Length = 227 Score = 71.2 bits (173), Expect = 5e-13 Identities = 38/62 (61%), Positives = 45/62 (72%), Gaps = 2/62 (3%) Frame = +1 Query: 97 THRNRTLKTEHNKMSSSRRKVILNSVSVKLGCGTCRRPKLIGFLFHTKPKPK--NPTYQK 270 TH N T+ MS SR+K++LN+VSVKLGCGTCRRP L +FH KPKPK N TY+K Sbjct: 5 THGN----TDTTAMSGSRKKLLLNTVSVKLGCGTCRRPNLCR-IFHPKPKPKNLNNTYRK 59 Query: 271 HK 276 HK Sbjct: 60 HK 61 >XP_015970618.1 PREDICTED: transcription repressor OFP6-like [Arachis duranensis] Length = 191 Score = 69.7 bits (169), Expect = 1e-12 Identities = 34/49 (69%), Positives = 42/49 (85%), Gaps = 1/49 (2%) Frame = +1 Query: 139 SSSRRKVILNSVSVKLGCGT-CRRPKLIGFLFHTKPKPKNPTYQKHKLY 282 +S+R+K+ LN+VSVKLGCG+ CRRPKL +FH KPKPKNPT QKHKL+ Sbjct: 3 TSARKKLHLNTVSVKLGCGSSCRRPKL-SRIFHPKPKPKNPTLQKHKLF 50 >XP_016207706.1 PREDICTED: transcription repressor OFP6 [Arachis ipaensis] Length = 195 Score = 69.7 bits (169), Expect = 1e-12 Identities = 34/49 (69%), Positives = 42/49 (85%), Gaps = 1/49 (2%) Frame = +1 Query: 139 SSSRRKVILNSVSVKLGCGT-CRRPKLIGFLFHTKPKPKNPTYQKHKLY 282 +S+R+K+ LN+VSVKLGCG+ CRRPKL +FH KPKPKNPT QKHKL+ Sbjct: 3 TSARKKLHLNTVSVKLGCGSSCRRPKL-SRIFHPKPKPKNPTLQKHKLF 50 >XP_004497705.1 PREDICTED: transcription repressor OFP6 [Cicer arietinum] Length = 168 Score = 68.9 bits (167), Expect = 1e-12 Identities = 31/49 (63%), Positives = 40/49 (81%) Frame = +1 Query: 136 MSSSRRKVILNSVSVKLGCGTCRRPKLIGFLFHTKPKPKNPTYQKHKLY 282 MSSS++K+ LN+VSV LGCGTC+RPK +F+ KPKPK P YQK+KL+ Sbjct: 1 MSSSKKKLTLNTVSVNLGCGTCKRPK-FSLIFNPKPKPKKPIYQKNKLH 48 >XP_003519129.2 PREDICTED: transcription repressor OFP6-like [Glycine max] KRH72226.1 hypothetical protein GLYMA_02G199300 [Glycine max] Length = 174 Score = 68.9 bits (167), Expect = 2e-12 Identities = 29/46 (63%), Positives = 37/46 (80%) Frame = +1 Query: 136 MSSSRRKVILNSVSVKLGCGTCRRPKLIGFLFHTKPKPKNPTYQKH 273 MSSSR+K++LN+VSV LGCG+CRRP L+ +FH K +PK P YQ H Sbjct: 1 MSSSRKKLVLNTVSVSLGCGSCRRPGLLRHIFHPKRRPKKPAYQAH 46 >KHN33168.1 hypothetical protein glysoja_039484 [Glycine soja] Length = 188 Score = 68.9 bits (167), Expect = 2e-12 Identities = 34/49 (69%), Positives = 40/49 (81%), Gaps = 2/49 (4%) Frame = +1 Query: 136 MSSSRRKVILNSVSVKLGCGTCRRPKLIGFLFHTKPKPK--NPTYQKHK 276 MS SR+K++LN+VSVKLGCGTCRRP L +FH KPKPK N TY+KHK Sbjct: 1 MSGSRKKLLLNTVSVKLGCGTCRRPNLCR-IFHPKPKPKNLNNTYRKHK 48 >KHN02184.1 hypothetical protein glysoja_002208 [Glycine soja] KRG96237.1 hypothetical protein GLYMA_19G197800 [Glycine max] Length = 191 Score = 68.9 bits (167), Expect = 2e-12 Identities = 34/49 (69%), Positives = 40/49 (81%), Gaps = 2/49 (4%) Frame = +1 Query: 136 MSSSRRKVILNSVSVKLGCGTCRRPKLIGFLFHTKPKPK--NPTYQKHK 276 MS SR+K++LN+VSVKLGCGTCRRP L +FH KPKPK N TY+KHK Sbjct: 1 MSGSRKKLLLNTVSVKLGCGTCRRPNLCR-IFHPKPKPKNLNNTYRKHK 48 >XP_003535805.1 PREDICTED: transcription repressor OFP6-like [Glycine max] KRH32810.1 hypothetical protein GLYMA_10G077800 [Glycine max] Length = 177 Score = 68.2 bits (165), Expect = 3e-12 Identities = 29/49 (59%), Positives = 39/49 (79%) Frame = +1 Query: 136 MSSSRRKVILNSVSVKLGCGTCRRPKLIGFLFHTKPKPKNPTYQKHKLY 282 MSSSR+K++LN+VSV LGCG+CRRP+L+ +FH K +PK P Q H L+ Sbjct: 1 MSSSRKKLVLNTVSVSLGCGSCRRPRLLRHIFHPKQRPKKPAGQVHGLH 49 >XP_017417726.1 PREDICTED: transcription repressor OFP6-like [Vigna angularis] Length = 188 Score = 68.2 bits (165), Expect = 4e-12 Identities = 33/48 (68%), Positives = 40/48 (83%), Gaps = 1/48 (2%) Frame = +1 Query: 136 MSSSRRKVILNSVSVKLGCGTCRRPKLIGFLFHTKPKPKN-PTYQKHK 276 MS+SR+K++LN+VSVKLGCGTCR PKL +FH KPKPK P+YQ HK Sbjct: 1 MSASRKKLLLNTVSVKLGCGTCRGPKLYR-IFHPKPKPKKLPSYQNHK 47 >BAT85910.1 hypothetical protein VIGAN_04350900 [Vigna angularis var. angularis] Length = 188 Score = 68.2 bits (165), Expect = 4e-12 Identities = 33/48 (68%), Positives = 40/48 (83%), Gaps = 1/48 (2%) Frame = +1 Query: 136 MSSSRRKVILNSVSVKLGCGTCRRPKLIGFLFHTKPKPKN-PTYQKHK 276 MS+SR+K++LN+VSVKLGCGTCR PKL +FH KPKPK P+YQ HK Sbjct: 1 MSASRKKLLLNTVSVKLGCGTCRGPKLYR-IFHPKPKPKKLPSYQNHK 47 >KOM39088.1 hypothetical protein LR48_Vigan03g247000 [Vigna angularis] Length = 200 Score = 68.2 bits (165), Expect = 5e-12 Identities = 33/48 (68%), Positives = 40/48 (83%), Gaps = 1/48 (2%) Frame = +1 Query: 136 MSSSRRKVILNSVSVKLGCGTCRRPKLIGFLFHTKPKPKN-PTYQKHK 276 MS+SR+K++LN+VSVKLGCGTCR PKL +FH KPKPK P+YQ HK Sbjct: 1 MSASRKKLLLNTVSVKLGCGTCRGPKLYR-IFHPKPKPKKLPSYQNHK 47