BLASTX nr result
ID: Glycyrrhiza30_contig00039618
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00039618 (240 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP42250.1 Heat stress transcription factor B-4 [Cajanus cajan] 110 6e-28 XP_012068333.1 PREDICTED: heat stress transcription factor B-4 [... 110 3e-27 XP_011074417.1 PREDICTED: LOW QUALITY PROTEIN: heat stress trans... 110 4e-27 OAY50946.1 hypothetical protein MANES_05G174900 [Manihot esculenta] 109 5e-27 CBI19505.3 unnamed protein product, partial [Vitis vinifera] 108 5e-27 CDP01323.1 unnamed protein product [Coffea canephora] 108 5e-27 XP_006434743.1 hypothetical protein CICLE_v10001482mg [Citrus cl... 109 7e-27 XP_006473306.1 PREDICTED: heat stress transcription factor B-4 [... 109 7e-27 XP_012452468.1 PREDICTED: heat stress transcription factor B-4-l... 108 9e-27 XP_007017200.2 PREDICTED: heat stress transcription factor B-4 [... 108 1e-26 EOY14425.1 Heat shock transcription factor B4 [Theobroma cacao] 108 1e-26 XP_016730622.1 PREDICTED: heat stress transcription factor B-4-l... 108 1e-26 XP_003528294.1 PREDICTED: heat stress transcription factor B-4 [... 108 1e-26 XP_014499941.1 PREDICTED: heat stress transcription factor B-4-l... 108 1e-26 XP_007136692.1 hypothetical protein PHAVU_009G065800g [Phaseolus... 108 1e-26 XP_017435170.1 PREDICTED: heat stress transcription factor B-4-l... 108 1e-26 XP_012452467.1 PREDICTED: heat stress transcription factor B-4-l... 108 1e-26 XP_016730621.1 PREDICTED: heat stress transcription factor B-4-l... 108 1e-26 XP_017644806.1 PREDICTED: heat stress transcription factor B-4-l... 108 1e-26 XP_010263520.1 PREDICTED: heat stress transcription factor B-4-l... 108 1e-26 >KYP42250.1 Heat stress transcription factor B-4 [Cajanus cajan] Length = 297 Score = 110 bits (276), Expect = 6e-28 Identities = 52/52 (100%), Positives = 52/52 (100%) Frame = +3 Query: 84 MALLLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPTTDHIVSWGEDDTTFV 239 MALLLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPTTDHIVSWGEDDTTFV Sbjct: 1 MALLLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPTTDHIVSWGEDDTTFV 52 >XP_012068333.1 PREDICTED: heat stress transcription factor B-4 [Jatropha curcas] KDP41719.1 hypothetical protein JCGZ_16126 [Jatropha curcas] Length = 361 Score = 110 bits (274), Expect = 3e-27 Identities = 51/52 (98%), Positives = 52/52 (100%) Frame = +3 Query: 84 MALLLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPTTDHIVSWGEDDTTFV 239 MAL+LDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPTTDHIVSWGEDDTTFV Sbjct: 1 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPTTDHIVSWGEDDTTFV 52 >XP_011074417.1 PREDICTED: LOW QUALITY PROTEIN: heat stress transcription factor B-4-like [Sesamum indicum] Length = 371 Score = 110 bits (274), Expect = 4e-27 Identities = 51/52 (98%), Positives = 52/52 (100%) Frame = +3 Query: 84 MALLLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPTTDHIVSWGEDDTTFV 239 MAL+LDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPTTDHIVSWGEDDTTFV Sbjct: 1 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPTTDHIVSWGEDDTTFV 52 >OAY50946.1 hypothetical protein MANES_05G174900 [Manihot esculenta] Length = 358 Score = 109 bits (273), Expect = 5e-27 Identities = 50/52 (96%), Positives = 52/52 (100%) Frame = +3 Query: 84 MALLLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPTTDHIVSWGEDDTTFV 239 MAL+LDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPTTDHIVSWGEDDTTF+ Sbjct: 1 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPTTDHIVSWGEDDTTFI 52 >CBI19505.3 unnamed protein product, partial [Vitis vinifera] Length = 281 Score = 108 bits (269), Expect = 5e-27 Identities = 50/52 (96%), Positives = 51/52 (98%) Frame = +3 Query: 84 MALLLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPTTDHIVSWGEDDTTFV 239 MAL+LDNCEGILLSLDSHKSVPAPFLTKTYQLVDDP TDHIVSWGEDDTTFV Sbjct: 1 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFV 52 >CDP01323.1 unnamed protein product [Coffea canephora] Length = 299 Score = 108 bits (270), Expect = 5e-27 Identities = 50/52 (96%), Positives = 52/52 (100%) Frame = +3 Query: 84 MALLLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPTTDHIVSWGEDDTTFV 239 MAL+LDNCEGILLSLDSHKSVPAPFLTKTYQLVDDP+TDHIVSWGEDDTTFV Sbjct: 1 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPSTDHIVSWGEDDTTFV 52 >XP_006434743.1 hypothetical protein CICLE_v10001482mg [Citrus clementina] ESR47983.1 hypothetical protein CICLE_v10001482mg [Citrus clementina] Length = 383 Score = 109 bits (273), Expect = 7e-27 Identities = 50/52 (96%), Positives = 52/52 (100%) Frame = +3 Query: 84 MALLLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPTTDHIVSWGEDDTTFV 239 MAL+LDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPTTDH+VSWGEDDTTFV Sbjct: 1 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPTTDHVVSWGEDDTTFV 52 >XP_006473306.1 PREDICTED: heat stress transcription factor B-4 [Citrus sinensis] KDO84134.1 hypothetical protein CISIN_1g016692mg [Citrus sinensis] Length = 384 Score = 109 bits (273), Expect = 7e-27 Identities = 50/52 (96%), Positives = 52/52 (100%) Frame = +3 Query: 84 MALLLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPTTDHIVSWGEDDTTFV 239 MAL+LDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPTTDH+VSWGEDDTTFV Sbjct: 1 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPTTDHVVSWGEDDTTFV 52 >XP_012452468.1 PREDICTED: heat stress transcription factor B-4-like isoform X2 [Gossypium raimondii] KJB63866.1 hypothetical protein B456_010G020700 [Gossypium raimondii] Length = 317 Score = 108 bits (269), Expect = 9e-27 Identities = 50/52 (96%), Positives = 51/52 (98%) Frame = +3 Query: 84 MALLLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPTTDHIVSWGEDDTTFV 239 MAL+LDNCEGILLSLDSHK VPAPFLTKTYQLVDDPTTDHIVSWGEDDTTFV Sbjct: 1 MALMLDNCEGILLSLDSHKPVPAPFLTKTYQLVDDPTTDHIVSWGEDDTTFV 52 >XP_007017200.2 PREDICTED: heat stress transcription factor B-4 [Theobroma cacao] Length = 361 Score = 108 bits (271), Expect = 1e-26 Identities = 50/52 (96%), Positives = 52/52 (100%) Frame = +3 Query: 84 MALLLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPTTDHIVSWGEDDTTFV 239 MA++LDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPTTDHIVSWGEDDTTFV Sbjct: 1 MAVILDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPTTDHIVSWGEDDTTFV 52 >EOY14425.1 Heat shock transcription factor B4 [Theobroma cacao] Length = 361 Score = 108 bits (271), Expect = 1e-26 Identities = 50/52 (96%), Positives = 52/52 (100%) Frame = +3 Query: 84 MALLLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPTTDHIVSWGEDDTTFV 239 MA++LDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPTTDHIVSWGEDDTTFV Sbjct: 1 MAVILDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPTTDHIVSWGEDDTTFV 52 >XP_016730622.1 PREDICTED: heat stress transcription factor B-4-like isoform X2 [Gossypium hirsutum] XP_016730624.1 PREDICTED: heat stress transcription factor B-4-like isoform X2 [Gossypium hirsutum] Length = 318 Score = 108 bits (269), Expect = 1e-26 Identities = 50/52 (96%), Positives = 51/52 (98%) Frame = +3 Query: 84 MALLLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPTTDHIVSWGEDDTTFV 239 MAL+LDNCEGILLSLDSHK VPAPFLTKTYQLVDDPTTDHIVSWGEDDTTFV Sbjct: 1 MALMLDNCEGILLSLDSHKPVPAPFLTKTYQLVDDPTTDHIVSWGEDDTTFV 52 >XP_003528294.1 PREDICTED: heat stress transcription factor B-4 [Glycine max] ABC47863.1 Heat shock transcription factor (HSF) [Glycine max] KHN22329.1 Heat stress transcription factor B-4 [Glycine soja] KRH52011.1 hypothetical protein GLYMA_06G040900 [Glycine max] Length = 363 Score = 108 bits (271), Expect = 1e-26 Identities = 51/52 (98%), Positives = 51/52 (98%) Frame = +3 Query: 84 MALLLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPTTDHIVSWGEDDTTFV 239 MALLLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDP TDHIVSWGEDDTTFV Sbjct: 1 MALLLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFV 52 >XP_014499941.1 PREDICTED: heat stress transcription factor B-4-like [Vigna radiata var. radiata] Length = 364 Score = 108 bits (271), Expect = 1e-26 Identities = 51/52 (98%), Positives = 51/52 (98%) Frame = +3 Query: 84 MALLLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPTTDHIVSWGEDDTTFV 239 MALLLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDP TDHIVSWGEDDTTFV Sbjct: 1 MALLLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFV 52 >XP_007136692.1 hypothetical protein PHAVU_009G065800g [Phaseolus vulgaris] ESW08686.1 hypothetical protein PHAVU_009G065800g [Phaseolus vulgaris] Length = 364 Score = 108 bits (271), Expect = 1e-26 Identities = 51/52 (98%), Positives = 51/52 (98%) Frame = +3 Query: 84 MALLLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPTTDHIVSWGEDDTTFV 239 MALLLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDP TDHIVSWGEDDTTFV Sbjct: 1 MALLLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFV 52 >XP_017435170.1 PREDICTED: heat stress transcription factor B-4-like [Vigna angularis] KOM51500.1 hypothetical protein LR48_Vigan09g015900 [Vigna angularis] BAT77852.1 hypothetical protein VIGAN_02045300 [Vigna angularis var. angularis] Length = 367 Score = 108 bits (271), Expect = 1e-26 Identities = 51/52 (98%), Positives = 51/52 (98%) Frame = +3 Query: 84 MALLLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPTTDHIVSWGEDDTTFV 239 MALLLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDP TDHIVSWGEDDTTFV Sbjct: 1 MALLLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPATDHIVSWGEDDTTFV 52 >XP_012452467.1 PREDICTED: heat stress transcription factor B-4-like isoform X1 [Gossypium raimondii] KJB63865.1 hypothetical protein B456_010G020700 [Gossypium raimondii] KJB63867.1 hypothetical protein B456_010G020700 [Gossypium raimondii] Length = 324 Score = 108 bits (269), Expect = 1e-26 Identities = 50/52 (96%), Positives = 51/52 (98%) Frame = +3 Query: 84 MALLLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPTTDHIVSWGEDDTTFV 239 MAL+LDNCEGILLSLDSHK VPAPFLTKTYQLVDDPTTDHIVSWGEDDTTFV Sbjct: 1 MALMLDNCEGILLSLDSHKPVPAPFLTKTYQLVDDPTTDHIVSWGEDDTTFV 52 >XP_016730621.1 PREDICTED: heat stress transcription factor B-4-like isoform X1 [Gossypium hirsutum] XP_016730623.1 PREDICTED: heat stress transcription factor B-4-like isoform X1 [Gossypium hirsutum] Length = 325 Score = 108 bits (269), Expect = 1e-26 Identities = 50/52 (96%), Positives = 51/52 (98%) Frame = +3 Query: 84 MALLLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPTTDHIVSWGEDDTTFV 239 MAL+LDNCEGILLSLDSHK VPAPFLTKTYQLVDDPTTDHIVSWGEDDTTFV Sbjct: 1 MALMLDNCEGILLSLDSHKPVPAPFLTKTYQLVDDPTTDHIVSWGEDDTTFV 52 >XP_017644806.1 PREDICTED: heat stress transcription factor B-4-like [Gossypium arboreum] KHG03540.1 Heat stress transcription factor B-4 -like protein [Gossypium arboreum] Length = 325 Score = 108 bits (269), Expect = 1e-26 Identities = 50/52 (96%), Positives = 51/52 (98%) Frame = +3 Query: 84 MALLLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPTTDHIVSWGEDDTTFV 239 MAL+LDNCEGILLSLDSHK VPAPFLTKTYQLVDDPTTDHIVSWGEDDTTFV Sbjct: 1 MALMLDNCEGILLSLDSHKPVPAPFLTKTYQLVDDPTTDHIVSWGEDDTTFV 52 >XP_010263520.1 PREDICTED: heat stress transcription factor B-4-like [Nelumbo nucifera] Length = 365 Score = 108 bits (270), Expect = 1e-26 Identities = 50/52 (96%), Positives = 52/52 (100%) Frame = +3 Query: 84 MALLLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPTTDHIVSWGEDDTTFV 239 MAL+LDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPTTDHIVSWGED+TTFV Sbjct: 1 MALMLDNCEGILLSLDSHKSVPAPFLTKTYQLVDDPTTDHIVSWGEDETTFV 52