BLASTX nr result
ID: Glycyrrhiza30_contig00039071
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00039071 (215 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003534794.2 PREDICTED: twinkle homolog protein, chloroplastic... 54 1e-06 XP_004512933.1 PREDICTED: twinkle homolog protein, chloroplastic... 52 5e-06 KHN14293.1 DNA primase/helicase [Glycine soja] 52 6e-06 XP_003546288.2 PREDICTED: twinkle homolog protein, chloroplastic... 52 6e-06 >XP_003534794.2 PREDICTED: twinkle homolog protein, chloroplastic/mitochondrial [Glycine max] KHN44661.1 DNA primase/helicase [Glycine soja] KRH36856.1 hypothetical protein GLYMA_09G028600 [Glycine max] Length = 700 Score = 53.5 bits (127), Expect = 1e-06 Identities = 32/65 (49%), Positives = 34/65 (52%), Gaps = 6/65 (9%) Frame = -2 Query: 181 MRFRYPHKTXXXXXXXXXLATMTTQPLFHSSTPFSN------SQTHRFRARRALFTVFCS 20 MR RY H L TMTTQ FHSS PF N SQ HRF R FTVFCS Sbjct: 1 MRLRYSHTLRPLLFTSSKLTTMTTQTFFHSS-PFPNLKNTLFSQRHRFPCHRPFFTVFCS 59 Query: 19 KHVSK 5 K +S+ Sbjct: 60 KPISR 64 >XP_004512933.1 PREDICTED: twinkle homolog protein, chloroplastic/mitochondrial [Cicer arietinum] Length = 697 Score = 52.0 bits (123), Expect = 5e-06 Identities = 34/71 (47%), Positives = 42/71 (59%), Gaps = 6/71 (8%) Frame = -2 Query: 211 LHSLFSVSQNMRFRYPHKTXXXXXXXXXLATMTTQPLFHSSTPFSNSQ------THRFRA 50 + S+F VSQNMRFRY H +M TQ L +STPFSN + THRF+ Sbjct: 1 MSSIF-VSQNMRFRYHHALIVPFF------SMNTQTL-SNSTPFSNLKKPLSFLTHRFQP 52 Query: 49 RRALFTVFCSK 17 +R +FTVFCSK Sbjct: 53 KRTIFTVFCSK 63 >KHN14293.1 DNA primase/helicase [Glycine soja] Length = 698 Score = 51.6 bits (122), Expect = 6e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 6/65 (9%) Frame = -2 Query: 181 MRFRYPHKTXXXXXXXXXLATMTTQPLFHSSTPFSN------SQTHRFRARRALFTVFCS 20 MR RYPH T L TM TQ LFHSS PF N SQ RF + R FTVFCS Sbjct: 1 MRLRYPH-TLLPLFTSLKLTTMNTQTLFHSS-PFPNLKNTFFSQRRRFPSHRPFFTVFCS 58 Query: 19 KHVSK 5 K +S+ Sbjct: 59 KPISR 63 >XP_003546288.2 PREDICTED: twinkle homolog protein, chloroplastic/mitochondrial-like [Glycine max] KRH11847.1 hypothetical protein GLYMA_15G134500 [Glycine max] Length = 698 Score = 51.6 bits (122), Expect = 6e-06 Identities = 33/65 (50%), Positives = 36/65 (55%), Gaps = 6/65 (9%) Frame = -2 Query: 181 MRFRYPHKTXXXXXXXXXLATMTTQPLFHSSTPFSN------SQTHRFRARRALFTVFCS 20 MR RYPH T L TM TQ LFHSS PF N SQ RF + R FTVFCS Sbjct: 1 MRLRYPH-TLLPLFTSLKLTTMNTQTLFHSS-PFPNLKNTFFSQRRRFPSHRPFFTVFCS 58 Query: 19 KHVSK 5 K +S+ Sbjct: 59 KPISR 63