BLASTX nr result
ID: Glycyrrhiza30_contig00038970
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00038970 (265 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004494356.1 PREDICTED: uncharacterized protein LOC101507267 [... 57 1e-07 >XP_004494356.1 PREDICTED: uncharacterized protein LOC101507267 [Cicer arietinum] Length = 311 Score = 57.0 bits (136), Expect = 1e-07 Identities = 26/35 (74%), Positives = 29/35 (82%) Frame = -3 Query: 263 VALAKLKNSKSGLLVEDSCIFEAEFTVLGLITPRN 159 VALAKL N SG LV+D+CIFE EF V+GLITPRN Sbjct: 276 VALAKLNNQNSGFLVDDACIFEVEFVVIGLITPRN 310