BLASTX nr result
ID: Glycyrrhiza30_contig00038338
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00038338 (455 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_006602587.1 PREDICTED: pectin acetylesterase 5-like isoform X... 55 4e-06 KRG99917.1 hypothetical protein GLYMA_18G179800 [Glycine max] 55 4e-06 XP_006602586.1 PREDICTED: pectin acetylesterase 5-like isoform X... 55 4e-06 XP_006602585.1 PREDICTED: pectin acetylesterase 5-like isoform X... 55 4e-06 XP_003551467.1 PREDICTED: pectin acetylesterase 5-like isoform X... 55 4e-06 KHN16240.1 Protein notum like [Glycine soja] 55 4e-06 XP_018841731.1 PREDICTED: pectin acetylesterase 5-like [Juglans ... 55 5e-06 KYP74298.1 Protein notum isogeny [Cajanus cajan] 54 9e-06 XP_003623071.2 pectinacetylesterase family protein [Medicago tru... 54 1e-05 >XP_006602587.1 PREDICTED: pectin acetylesterase 5-like isoform X4 [Glycine max] Length = 346 Score = 55.5 bits (132), Expect = 4e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +2 Query: 365 SLLSGCSAGGLTTLIHCDELQQVLPKEATV 454 +LLSGCSAGGL TLIHCD +QVLPKEATV Sbjct: 203 ALLSGCSAGGLATLIHCDSFRQVLPKEATV 232 >KRG99917.1 hypothetical protein GLYMA_18G179800 [Glycine max] Length = 349 Score = 55.5 bits (132), Expect = 4e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +2 Query: 365 SLLSGCSAGGLTTLIHCDELQQVLPKEATV 454 +LLSGCSAGGL TLIHCD +QVLPKEATV Sbjct: 202 ALLSGCSAGGLATLIHCDSFRQVLPKEATV 231 >XP_006602586.1 PREDICTED: pectin acetylesterase 5-like isoform X3 [Glycine max] Length = 350 Score = 55.5 bits (132), Expect = 4e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +2 Query: 365 SLLSGCSAGGLTTLIHCDELQQVLPKEATV 454 +LLSGCSAGGL TLIHCD +QVLPKEATV Sbjct: 203 ALLSGCSAGGLATLIHCDSFRQVLPKEATV 232 >XP_006602585.1 PREDICTED: pectin acetylesterase 5-like isoform X2 [Glycine max] KRG99916.1 hypothetical protein GLYMA_18G179800 [Glycine max] Length = 427 Score = 55.5 bits (132), Expect = 4e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +2 Query: 365 SLLSGCSAGGLTTLIHCDELQQVLPKEATV 454 +LLSGCSAGGL TLIHCD +QVLPKEATV Sbjct: 202 ALLSGCSAGGLATLIHCDSFRQVLPKEATV 231 >XP_003551467.1 PREDICTED: pectin acetylesterase 5-like isoform X1 [Glycine max] Length = 428 Score = 55.5 bits (132), Expect = 4e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +2 Query: 365 SLLSGCSAGGLTTLIHCDELQQVLPKEATV 454 +LLSGCSAGGL TLIHCD +QVLPKEATV Sbjct: 203 ALLSGCSAGGLATLIHCDSFRQVLPKEATV 232 >KHN16240.1 Protein notum like [Glycine soja] Length = 435 Score = 55.5 bits (132), Expect = 4e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = +2 Query: 365 SLLSGCSAGGLTTLIHCDELQQVLPKEATV 454 +LLSGCSAGGL TLIHCD +QVLPKEATV Sbjct: 206 ALLSGCSAGGLATLIHCDSFRQVLPKEATV 235 >XP_018841731.1 PREDICTED: pectin acetylesterase 5-like [Juglans regia] Length = 421 Score = 55.1 bits (131), Expect = 5e-06 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = +2 Query: 365 SLLSGCSAGGLTTLIHCDELQQVLPKEATV 454 +LLSGCSAGGL TLIHCD+ QQ+LPK+AT+ Sbjct: 199 ALLSGCSAGGLATLIHCDDFQQLLPKDATI 228 >KYP74298.1 Protein notum isogeny [Cajanus cajan] Length = 402 Score = 54.3 bits (129), Expect = 9e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = +2 Query: 365 SLLSGCSAGGLTTLIHCDELQQVLPKEATV 454 +LLSGCSAGGL TLIHCD +Q+LPKEATV Sbjct: 195 ALLSGCSAGGLATLIHCDNFRQLLPKEATV 224 >XP_003623071.2 pectinacetylesterase family protein [Medicago truncatula] AES79289.2 pectinacetylesterase family protein [Medicago truncatula] Length = 420 Score = 54.3 bits (129), Expect = 1e-05 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = +2 Query: 365 SLLSGCSAGGLTTLIHCDELQQVLPKEATV 454 +LLSGCSAGGL TLIHCD +Q+LPKEATV Sbjct: 198 ALLSGCSAGGLATLIHCDNFRQLLPKEATV 227