BLASTX nr result
ID: Glycyrrhiza30_contig00038144
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00038144 (258 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_015966588.1 PREDICTED: receptor-like protein kinase HSL1 [Ara... 55 9e-07 XP_016203782.1 PREDICTED: receptor-like protein kinase HSL1 [Ara... 54 2e-06 >XP_015966588.1 PREDICTED: receptor-like protein kinase HSL1 [Arachis duranensis] Length = 1014 Score = 54.7 bits (130), Expect = 9e-07 Identities = 28/43 (65%), Positives = 33/43 (76%), Gaps = 1/43 (2%) Frame = -3 Query: 256 RPSMKEVLQVLLQQGEPFACRERN-IDQSDFAPLLRNSKREYK 131 RP+MKE LQVLLQ GE ++ ERN + Q D PLLRNSKRE+K Sbjct: 963 RPTMKEALQVLLQSGESYSFGERNSVGQCDAVPLLRNSKREHK 1005 >XP_016203782.1 PREDICTED: receptor-like protein kinase HSL1 [Arachis ipaensis] Length = 1014 Score = 53.5 bits (127), Expect = 2e-06 Identities = 27/43 (62%), Positives = 33/43 (76%), Gaps = 1/43 (2%) Frame = -3 Query: 256 RPSMKEVLQVLLQQGEPFACRERN-IDQSDFAPLLRNSKREYK 131 RP+MKE LQ+LLQ GE ++ ERN + Q D PLLRNSKRE+K Sbjct: 963 RPTMKEALQLLLQSGESYSFGERNSVGQCDAVPLLRNSKREHK 1005