BLASTX nr result
ID: Glycyrrhiza30_contig00037976
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00037976 (388 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003614684.1 transmembrane protein, putative [Medicago truncat... 60 1e-09 KYP43193.1 Leucine-rich repeat receptor protein kinase EXS [Caja... 61 2e-08 XP_006584945.1 PREDICTED: probably inactive leucine-rich repeat ... 57 8e-07 >XP_003614684.1 transmembrane protein, putative [Medicago truncatula] AES97642.1 transmembrane protein, putative [Medicago truncatula] Length = 93 Score = 60.5 bits (145), Expect = 1e-09 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = +3 Query: 204 MEFSDQFHESFRQGLTAGYFFALTFVLVFYIFYCLP 311 MEFS+QF ESF+ GL AGY F TFV+VFY+FYCLP Sbjct: 1 MEFSNQFKESFKHGLIAGYCFTATFVIVFYMFYCLP 36 >KYP43193.1 Leucine-rich repeat receptor protein kinase EXS [Cajanus cajan] Length = 377 Score = 60.8 bits (146), Expect = 2e-08 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +3 Query: 204 MEFSDQFHESFRQGLTAGYFFALTFVLVFYIFYCLP 311 ME S+QFHESFRQGLTAGY FA TF +V Y+ YCLP Sbjct: 1 MESSNQFHESFRQGLTAGYVFAATFFIVIYMSYCLP 36 >XP_006584945.1 PREDICTED: probably inactive leucine-rich repeat receptor-like protein kinase At5g48380 [Glycine max] XP_006584946.1 PREDICTED: probably inactive leucine-rich repeat receptor-like protein kinase At5g48380 [Glycine max] KHN45720.1 Probably inactive leucine-rich repeat receptor-like protein kinase [Glycine soja] KRH42000.1 hypothetical protein GLYMA_08G062800 [Glycine max] Length = 386 Score = 56.6 bits (135), Expect = 8e-07 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = +3 Query: 204 MEFSDQFHESFRQGLTAGYFFALTFVLVFYIFYCLP 311 ME S+QF+ESFRQGLTAGY FA TFV+V Y+ CLP Sbjct: 1 MESSNQFNESFRQGLTAGYVFAATFVIVLYMSSCLP 36