BLASTX nr result
ID: Glycyrrhiza30_contig00037811
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00037811 (251 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU35861.1 hypothetical protein TSUD_63510 [Trifolium subterraneum] 65 2e-10 >GAU35861.1 hypothetical protein TSUD_63510 [Trifolium subterraneum] Length = 483 Score = 64.7 bits (156), Expect = 2e-10 Identities = 31/66 (46%), Positives = 38/66 (57%), Gaps = 1/66 (1%) Frame = -3 Query: 201 SSTHLPMPSLDHCGLWLRIG-RGGASRSRNNFKFLSPWIDLVDFEPQVRSSWVPSDSWKG 25 S HLP+ + DHCGLWLR A N FKFL +D DF QVR+SW + W+ Sbjct: 86 SVIHLPLSTSDHCGLWLRPSPETNAGNRHNYFKFLGSCLDHPDFSNQVRNSWTSTSDWQE 145 Query: 24 NVSRLT 7 NV R+T Sbjct: 146 NVDRIT 151