BLASTX nr result
ID: Glycyrrhiza30_contig00037410
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00037410 (252 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004507163.1 PREDICTED: pentatricopeptide repeat-containing pr... 95 7e-21 GAU47971.1 hypothetical protein TSUD_87750 [Trifolium subterraneum] 85 9e-18 GAU47972.1 hypothetical protein TSUD_87760 [Trifolium subterraneum] 85 2e-17 XP_003606718.1 pentatricopeptide (PPR) repeat protein [Medicago ... 79 2e-15 XP_016187257.1 PREDICTED: pentatricopeptide repeat-containing pr... 77 9e-15 XP_003539074.1 PREDICTED: pentatricopeptide repeat-containing pr... 76 3e-14 XP_017406258.1 PREDICTED: pentatricopeptide repeat-containing pr... 75 6e-14 XP_014518730.1 PREDICTED: pentatricopeptide repeat-containing pr... 74 1e-13 XP_015952229.1 PREDICTED: pentatricopeptide repeat-containing pr... 74 2e-13 XP_015952228.1 PREDICTED: pentatricopeptide repeat-containing pr... 74 2e-13 XP_015952227.1 PREDICTED: pentatricopeptide repeat-containing pr... 74 2e-13 XP_007132042.1 hypothetical protein PHAVU_011G062000g [Phaseolus... 67 3e-11 XP_019449784.1 PREDICTED: pentatricopeptide repeat-containing pr... 57 1e-07 XP_012066972.1 PREDICTED: pentatricopeptide repeat-containing pr... 53 3e-06 XP_011035271.1 PREDICTED: pentatricopeptide repeat-containing pr... 53 3e-06 XP_010268581.2 PREDICTED: pentatricopeptide repeat-containing pr... 53 4e-06 >XP_004507163.1 PREDICTED: pentatricopeptide repeat-containing protein At5g59600 [Cicer arietinum] Length = 550 Score = 94.7 bits (234), Expect = 7e-21 Identities = 46/60 (76%), Positives = 53/60 (88%) Frame = -1 Query: 180 MHAVVRSTTFVRIPAKNAILSRHRFLRSEPEAYAELIDTYARDRALHDGKKLHAHLTTNG 1 MHA+VR+TT ++IPAKNAIL+ HR LRSEPEAYAELI+TY RDR+L GKKLHAHLT NG Sbjct: 1 MHALVRTTTSIKIPAKNAILN-HRLLRSEPEAYAELIETYTRDRSLQQGKKLHAHLTING 59 >GAU47971.1 hypothetical protein TSUD_87750 [Trifolium subterraneum] Length = 358 Score = 85.1 bits (209), Expect = 9e-18 Identities = 42/60 (70%), Positives = 49/60 (81%) Frame = -1 Query: 180 MHAVVRSTTFVRIPAKNAILSRHRFLRSEPEAYAELIDTYARDRALHDGKKLHAHLTTNG 1 MH ++R TT +RIP KNAI + HRFLRSEPE+YA+LI+ Y DRALH GKKLHA LTTNG Sbjct: 1 MHVLLRITTPLRIPTKNAIFN-HRFLRSEPESYAKLIEIYTHDRALHQGKKLHALLTTNG 59 >GAU47972.1 hypothetical protein TSUD_87760 [Trifolium subterraneum] Length = 550 Score = 85.1 bits (209), Expect = 2e-17 Identities = 42/60 (70%), Positives = 49/60 (81%) Frame = -1 Query: 180 MHAVVRSTTFVRIPAKNAILSRHRFLRSEPEAYAELIDTYARDRALHDGKKLHAHLTTNG 1 MH ++R TT +RIP KNAI + HRFLRSEPE+YA+LI+ Y DRALH GKKLHA LTTNG Sbjct: 1 MHVLLRITTPLRIPTKNAIFN-HRFLRSEPESYAKLIEIYTHDRALHQGKKLHALLTTNG 59 >XP_003606718.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] AES88915.1 pentatricopeptide (PPR) repeat protein [Medicago truncatula] Length = 550 Score = 79.3 bits (194), Expect = 2e-15 Identities = 39/60 (65%), Positives = 47/60 (78%) Frame = -1 Query: 180 MHAVVRSTTFVRIPAKNAILSRHRFLRSEPEAYAELIDTYARDRALHDGKKLHAHLTTNG 1 MHA VR+T ++IP KNAI + H FLRSEPE+YA+LI+TY R+L GKKLHA LTTNG Sbjct: 1 MHAFVRTTQSLKIPTKNAIFNHH-FLRSEPESYAKLIETYTHSRSLQQGKKLHALLTTNG 59 >XP_016187257.1 PREDICTED: pentatricopeptide repeat-containing protein At5g59600-like [Arachis ipaensis] Length = 590 Score = 77.4 bits (189), Expect = 9e-15 Identities = 39/60 (65%), Positives = 45/60 (75%) Frame = -1 Query: 180 MHAVVRSTTFVRIPAKNAILSRHRFLRSEPEAYAELIDTYARDRALHDGKKLHAHLTTNG 1 MHA ++T RIP NAI+ HR RS+P YA+LI+TYARDRALH GKKLHAHL TNG Sbjct: 1 MHAFHKTTLLPRIPITNAII--HRSFRSDPLFYAQLIETYARDRALHHGKKLHAHLITNG 58 >XP_003539074.1 PREDICTED: pentatricopeptide repeat-containing protein At5g59600 [Glycine max] KRH29749.1 hypothetical protein GLYMA_11G136400 [Glycine max] Length = 548 Score = 75.9 bits (185), Expect = 3e-14 Identities = 40/60 (66%), Positives = 44/60 (73%) Frame = -1 Query: 180 MHAVVRSTTFVRIPAKNAILSRHRFLRSEPEAYAELIDTYARDRALHDGKKLHAHLTTNG 1 MH +R + A N I+SRH F RSEPE+YAELID YARDRALH GKKLHAHL TNG Sbjct: 1 MHGPLRRNA--TLLATNGIISRH-FFRSEPESYAELIDMYARDRALHAGKKLHAHLVTNG 57 >XP_017406258.1 PREDICTED: pentatricopeptide repeat-containing protein At5g59600 [Vigna angularis] KOM26215.1 hypothetical protein LR48_Vigan238s004800 [Vigna angularis] BAT90746.1 hypothetical protein VIGAN_06202700 [Vigna angularis var. angularis] Length = 550 Score = 75.1 bits (183), Expect = 6e-14 Identities = 39/60 (65%), Positives = 45/60 (75%) Frame = -1 Query: 180 MHAVVRSTTFVRIPAKNAILSRHRFLRSEPEAYAELIDTYARDRALHDGKKLHAHLTTNG 1 MH ++RS T +RIPA N I++R RF RSE + AELID YARDRALH GKKLHA L T G Sbjct: 1 MHGLLRSPTLLRIPATNGIINR-RFFRSEQQRCAELIDIYARDRALHLGKKLHASLITEG 59 >XP_014518730.1 PREDICTED: pentatricopeptide repeat-containing protein At5g59600-like [Vigna radiata var. radiata] XP_014518739.1 PREDICTED: pentatricopeptide repeat-containing protein At5g59600-like [Vigna radiata var. radiata] XP_014518746.1 PREDICTED: pentatricopeptide repeat-containing protein At5g59600-like [Vigna radiata var. radiata] XP_014518755.1 PREDICTED: pentatricopeptide repeat-containing protein At5g59600-like [Vigna radiata var. radiata] XP_014518763.1 PREDICTED: pentatricopeptide repeat-containing protein At5g59600-like [Vigna radiata var. radiata] XP_014518771.1 PREDICTED: pentatricopeptide repeat-containing protein At5g59600-like [Vigna radiata var. radiata] Length = 550 Score = 73.9 bits (180), Expect = 1e-13 Identities = 38/60 (63%), Positives = 45/60 (75%) Frame = -1 Query: 180 MHAVVRSTTFVRIPAKNAILSRHRFLRSEPEAYAELIDTYARDRALHDGKKLHAHLTTNG 1 MH ++RS T +RIPA N I++R RF RSE + A+LID YARDRALH GKKLHA L T G Sbjct: 1 MHGLLRSPTLLRIPATNGIINR-RFFRSEQQRCADLIDIYARDRALHLGKKLHASLITKG 59 >XP_015952229.1 PREDICTED: pentatricopeptide repeat-containing protein At5g59600-like isoform X3 [Arachis duranensis] Length = 550 Score = 73.6 bits (179), Expect = 2e-13 Identities = 38/60 (63%), Positives = 43/60 (71%) Frame = -1 Query: 180 MHAVVRSTTFVRIPAKNAILSRHRFLRSEPEAYAELIDTYARDRALHDGKKLHAHLTTNG 1 MHA ++T RIP NAI+ R RS+P YA+LI TYARDRALH GKKLHAHL TNG Sbjct: 1 MHAFHKTTLLPRIPITNAIIRRS--FRSDPLFYAQLIQTYARDRALHHGKKLHAHLITNG 58 >XP_015952228.1 PREDICTED: pentatricopeptide repeat-containing protein At5g59600-like isoform X2 [Arachis duranensis] Length = 588 Score = 73.6 bits (179), Expect = 2e-13 Identities = 38/60 (63%), Positives = 43/60 (71%) Frame = -1 Query: 180 MHAVVRSTTFVRIPAKNAILSRHRFLRSEPEAYAELIDTYARDRALHDGKKLHAHLTTNG 1 MHA ++T RIP NAI+ R RS+P YA+LI TYARDRALH GKKLHAHL TNG Sbjct: 1 MHAFHKTTLLPRIPITNAIIRRS--FRSDPLFYAQLIQTYARDRALHHGKKLHAHLITNG 58 >XP_015952227.1 PREDICTED: pentatricopeptide repeat-containing protein At5g59600-like isoform X1 [Arachis duranensis] Length = 590 Score = 73.6 bits (179), Expect = 2e-13 Identities = 38/60 (63%), Positives = 43/60 (71%) Frame = -1 Query: 180 MHAVVRSTTFVRIPAKNAILSRHRFLRSEPEAYAELIDTYARDRALHDGKKLHAHLTTNG 1 MHA ++T RIP NAI+ R RS+P YA+LI TYARDRALH GKKLHAHL TNG Sbjct: 1 MHAFHKTTLLPRIPITNAIIRRS--FRSDPLFYAQLIQTYARDRALHHGKKLHAHLITNG 58 >XP_007132042.1 hypothetical protein PHAVU_011G062000g [Phaseolus vulgaris] ESW04036.1 hypothetical protein PHAVU_011G062000g [Phaseolus vulgaris] Length = 550 Score = 67.4 bits (163), Expect = 3e-11 Identities = 35/60 (58%), Positives = 42/60 (70%) Frame = -1 Query: 180 MHAVVRSTTFVRIPAKNAILSRHRFLRSEPEAYAELIDTYARDRALHDGKKLHAHLTTNG 1 MH ++RS T +RI N I++ RF SE + +AELID YARDRALH GKKLHA L T G Sbjct: 1 MHGLLRSPTLLRITTTNGIINS-RFFGSEHQRFAELIDVYARDRALHLGKKLHASLITKG 59 >XP_019449784.1 PREDICTED: pentatricopeptide repeat-containing protein At5g59600 [Lupinus angustifolius] OIW08642.1 hypothetical protein TanjilG_03318 [Lupinus angustifolius] Length = 547 Score = 57.4 bits (137), Expect = 1e-07 Identities = 27/38 (71%), Positives = 29/38 (76%) Frame = -1 Query: 114 HRFLRSEPEAYAELIDTYARDRALHDGKKLHAHLTTNG 1 +R+ RSE AYAELI YARD ALH GKKLHAHL T G Sbjct: 19 YRWFRSEASAYAELIGIYARDGALHQGKKLHAHLITTG 56 >XP_012066972.1 PREDICTED: pentatricopeptide repeat-containing protein At5g59600 [Jatropha curcas] KDP42221.1 hypothetical protein JCGZ_02951 [Jatropha curcas] Length = 543 Score = 53.1 bits (126), Expect = 3e-06 Identities = 27/60 (45%), Positives = 38/60 (63%) Frame = -1 Query: 180 MHAVVRSTTFVRIPAKNAILSRHRFLRSEPEAYAELIDTYARDRALHDGKKLHAHLTTNG 1 MH ++R+ TF ++ K I+ H RS + Y+ELI Y R++AL GK LHAHL T+G Sbjct: 1 MHILIRAPTFYKLHFKIPII--HNCFRSCSDLYSELIQIYTREQALQQGKILHAHLITSG 58 >XP_011035271.1 PREDICTED: pentatricopeptide repeat-containing protein At5g59600 [Populus euphratica] Length = 557 Score = 53.1 bits (126), Expect = 3e-06 Identities = 27/42 (64%), Positives = 29/42 (69%) Frame = -1 Query: 126 ILSRHRFLRSEPEAYAELIDTYARDRALHDGKKLHAHLTTNG 1 I+SR F RS E Y LI+TY RDRAL GKKLHAHL NG Sbjct: 27 IISRRSF-RSSSETYFHLIETYGRDRALQQGKKLHAHLIING 67 >XP_010268581.2 PREDICTED: pentatricopeptide repeat-containing protein At5g59600 [Nelumbo nucifera] Length = 565 Score = 52.8 bits (125), Expect = 4e-06 Identities = 26/44 (59%), Positives = 30/44 (68%) Frame = -1 Query: 132 NAILSRHRFLRSEPEAYAELIDTYARDRALHDGKKLHAHLTTNG 1 NAI HR +S + YA I+ YARDRALH G+KLHAHL NG Sbjct: 35 NAI--NHRTFQSASDIYANYIEIYARDRALHSGRKLHAHLIING 76