BLASTX nr result
ID: Glycyrrhiza30_contig00037048
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00037048 (281 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_004499305.1 PREDICTED: pentatricopeptide repeat-containing pr... 71 3e-12 XP_013466196.1 PPR containing plant-like protein [Medicago trunc... 69 1e-11 OIW01915.1 hypothetical protein TanjilG_15240 [Lupinus angustifo... 67 4e-11 XP_019461182.1 PREDICTED: pentatricopeptide repeat-containing pr... 67 4e-11 GAU12240.1 hypothetical protein TSUD_02080 [Trifolium subterraneum] 65 2e-10 GAU12241.1 hypothetical protein TSUD_02070 [Trifolium subterraneum] 65 2e-10 XP_012836976.1 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide... 57 2e-07 XP_019236419.1 PREDICTED: pentatricopeptide repeat-containing pr... 57 3e-07 XP_016505903.1 PREDICTED: pentatricopeptide repeat-containing pr... 57 3e-07 XP_009803628.1 PREDICTED: pentatricopeptide repeat-containing pr... 57 3e-07 XP_016467273.1 PREDICTED: pentatricopeptide repeat-containing pr... 57 3e-07 XP_009616749.1 PREDICTED: pentatricopeptide repeat-containing pr... 57 3e-07 XP_019165308.1 PREDICTED: pentatricopeptide repeat-containing pr... 57 3e-07 ONH91458.1 hypothetical protein PRUPE_8G116000 [Prunus persica] 55 7e-07 XP_003528385.1 PREDICTED: pentatricopeptide repeat-containing pr... 55 7e-07 XP_007201413.1 hypothetical protein PRUPE_ppa001679mg [Prunus pe... 55 7e-07 XP_006349130.1 PREDICTED: pentatricopeptide repeat-containing pr... 55 7e-07 XP_019066603.1 PREDICTED: pentatricopeptide repeat-containing pr... 55 7e-07 XP_015874239.1 PREDICTED: pentatricopeptide repeat-containing pr... 55 7e-07 KOM55983.1 hypothetical protein LR48_Vigan10g187500 [Vigna angul... 55 9e-07 >XP_004499305.1 PREDICTED: pentatricopeptide repeat-containing protein At2g15820 [Cicer arietinum] Length = 793 Score = 70.9 bits (172), Expect = 3e-12 Identities = 34/47 (72%), Positives = 39/47 (82%), Gaps = 5/47 (10%) Frame = +1 Query: 154 FRFDR-----SSAEAERLPRPEVEVKELSDVPELWRRSRVAWLCKEL 279 FRFDR + A+ +RLPRPEVEV EL++VPELWRRSRVAWLCKEL Sbjct: 92 FRFDRYLAVEAEADEKRLPRPEVEVMELNEVPELWRRSRVAWLCKEL 138 >XP_013466196.1 PPR containing plant-like protein [Medicago truncatula] KEH40237.1 PPR containing plant-like protein [Medicago truncatula] Length = 788 Score = 68.9 bits (167), Expect = 1e-11 Identities = 34/43 (79%), Positives = 35/43 (81%), Gaps = 1/43 (2%) Frame = +1 Query: 154 FRFDRSSA-EAERLPRPEVEVKELSDVPELWRRSRVAWLCKEL 279 F F A E RLPRPEVEVKELS+VPELWRRSRVAWLCKEL Sbjct: 91 FHFSTVEADEKRRLPRPEVEVKELSEVPELWRRSRVAWLCKEL 133 >OIW01915.1 hypothetical protein TanjilG_15240 [Lupinus angustifolius] Length = 762 Score = 67.4 bits (163), Expect = 4e-11 Identities = 32/46 (69%), Positives = 38/46 (82%), Gaps = 4/46 (8%) Frame = +1 Query: 154 FRFDRSS----AEAERLPRPEVEVKELSDVPELWRRSRVAWLCKEL 279 F+FDRSS AE +LP PE+EVKELS++PE WRRS+VAWLCKEL Sbjct: 64 FQFDRSSVSTVAEMRKLPSPEMEVKELSELPEQWRRSKVAWLCKEL 109 >XP_019461182.1 PREDICTED: pentatricopeptide repeat-containing protein At2g15820, chloroplastic [Lupinus angustifolius] XP_019461183.1 PREDICTED: pentatricopeptide repeat-containing protein At2g15820, chloroplastic [Lupinus angustifolius] Length = 793 Score = 67.4 bits (163), Expect = 4e-11 Identities = 32/46 (69%), Positives = 38/46 (82%), Gaps = 4/46 (8%) Frame = +1 Query: 154 FRFDRSS----AEAERLPRPEVEVKELSDVPELWRRSRVAWLCKEL 279 F+FDRSS AE +LP PE+EVKELS++PE WRRS+VAWLCKEL Sbjct: 95 FQFDRSSVSTVAEMRKLPSPEMEVKELSELPEQWRRSKVAWLCKEL 140 >GAU12240.1 hypothetical protein TSUD_02080 [Trifolium subterraneum] Length = 580 Score = 65.5 bits (158), Expect = 2e-10 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +1 Query: 178 EAERLPRPEVEVKELSDVPELWRRSRVAWLCKEL 279 + +RLPRPEVEV ELS+VPELWRRSRVAWLCKEL Sbjct: 89 DEKRLPRPEVEVMELSEVPELWRRSRVAWLCKEL 122 >GAU12241.1 hypothetical protein TSUD_02070 [Trifolium subterraneum] Length = 739 Score = 65.5 bits (158), Expect = 2e-10 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +1 Query: 178 EAERLPRPEVEVKELSDVPELWRRSRVAWLCKEL 279 + +RLPRPEVEV ELS+VPELWRRSRVAWLCKEL Sbjct: 59 DEKRLPRPEVEVMELSEVPELWRRSRVAWLCKEL 92 >XP_012836976.1 PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At2g15820 [Erythranthe guttata] Length = 781 Score = 57.0 bits (136), Expect = 2e-07 Identities = 27/44 (61%), Positives = 32/44 (72%), Gaps = 2/44 (4%) Frame = +1 Query: 154 FRFDRS--SAEAERLPRPEVEVKELSDVPELWRRSRVAWLCKEL 279 + FD S S E +R P VEVKEL D+PE WRRS++AWLCKEL Sbjct: 82 YNFDGSFESTELKRFESPAVEVKELDDLPEQWRRSKLAWLCKEL 125 >XP_019236419.1 PREDICTED: pentatricopeptide repeat-containing protein At2g15820, chloroplastic [Nicotiana attenuata] OIT23224.1 pentatricopeptide repeat-containing protein, chloroplastic [Nicotiana attenuata] Length = 797 Score = 56.6 bits (135), Expect = 3e-07 Identities = 26/44 (59%), Positives = 31/44 (70%), Gaps = 2/44 (4%) Frame = +1 Query: 154 FRFDRS--SAEAERLPRPEVEVKELSDVPELWRRSRVAWLCKEL 279 F FD S S E ++ P VEV EL D+P+ WRRSR+AWLCKEL Sbjct: 84 FNFDESFDSTELKKFETPAVEVSELEDIPDQWRRSRLAWLCKEL 127 >XP_016505903.1 PREDICTED: pentatricopeptide repeat-containing protein At2g15820, chloroplastic-like [Nicotiana tabacum] Length = 797 Score = 56.6 bits (135), Expect = 3e-07 Identities = 26/44 (59%), Positives = 31/44 (70%), Gaps = 2/44 (4%) Frame = +1 Query: 154 FRFDRS--SAEAERLPRPEVEVKELSDVPELWRRSRVAWLCKEL 279 F FD S S E ++ P VEV EL D+P+ WRRSR+AWLCKEL Sbjct: 84 FNFDESFDSTELKKFETPAVEVSELEDIPDQWRRSRLAWLCKEL 127 >XP_009803628.1 PREDICTED: pentatricopeptide repeat-containing protein At2g15820 [Nicotiana sylvestris] Length = 797 Score = 56.6 bits (135), Expect = 3e-07 Identities = 26/44 (59%), Positives = 31/44 (70%), Gaps = 2/44 (4%) Frame = +1 Query: 154 FRFDRS--SAEAERLPRPEVEVKELSDVPELWRRSRVAWLCKEL 279 F FD S S E ++ P VEV EL D+P+ WRRSR+AWLCKEL Sbjct: 84 FNFDESFDSTELKKFETPAVEVSELEDIPDQWRRSRLAWLCKEL 127 >XP_016467273.1 PREDICTED: pentatricopeptide repeat-containing protein At2g15820, chloroplastic-like [Nicotiana tabacum] Length = 802 Score = 56.6 bits (135), Expect = 3e-07 Identities = 26/44 (59%), Positives = 31/44 (70%), Gaps = 2/44 (4%) Frame = +1 Query: 154 FRFDRS--SAEAERLPRPEVEVKELSDVPELWRRSRVAWLCKEL 279 F FD S S E ++ P VEV EL D+P+ WRRSR+AWLCKEL Sbjct: 85 FNFDESFDSTELKKFETPAVEVSELEDIPDQWRRSRLAWLCKEL 128 >XP_009616749.1 PREDICTED: pentatricopeptide repeat-containing protein At2g15820, chloroplastic [Nicotiana tomentosiformis] Length = 802 Score = 56.6 bits (135), Expect = 3e-07 Identities = 26/44 (59%), Positives = 31/44 (70%), Gaps = 2/44 (4%) Frame = +1 Query: 154 FRFDRS--SAEAERLPRPEVEVKELSDVPELWRRSRVAWLCKEL 279 F FD S S E ++ P VEV EL D+P+ WRRSR+AWLCKEL Sbjct: 85 FNFDESFDSTELKKFETPAVEVSELEDIPDQWRRSRLAWLCKEL 128 >XP_019165308.1 PREDICTED: pentatricopeptide repeat-containing protein At2g15820, chloroplastic [Ipomoea nil] Length = 840 Score = 56.6 bits (135), Expect = 3e-07 Identities = 27/44 (61%), Positives = 32/44 (72%), Gaps = 2/44 (4%) Frame = +1 Query: 154 FRFDRS--SAEAERLPRPEVEVKELSDVPELWRRSRVAWLCKEL 279 F FD S S E +R P V+VKEL ++PE WRRSR+AWLCKEL Sbjct: 130 FNFDSSFESVELKRFDSPVVDVKELEELPEQWRRSRLAWLCKEL 173 >ONH91458.1 hypothetical protein PRUPE_8G116000 [Prunus persica] Length = 763 Score = 55.5 bits (132), Expect = 7e-07 Identities = 26/44 (59%), Positives = 33/44 (75%), Gaps = 2/44 (4%) Frame = +1 Query: 154 FRFDR--SSAEAERLPRPEVEVKELSDVPELWRRSRVAWLCKEL 279 F D+ SSA+ + L PE+EV EL D+PE WRRS++AWLCKEL Sbjct: 79 FNLDKCFSSADLKHLAVPELEVPELEDLPEQWRRSKLAWLCKEL 122 >XP_003528385.1 PREDICTED: pentatricopeptide repeat-containing protein At2g15820, chloroplastic-like [Glycine max] KRH49777.1 hypothetical protein GLYMA_07G178800 [Glycine max] Length = 763 Score = 55.5 bits (132), Expect = 7e-07 Identities = 27/37 (72%), Positives = 29/37 (78%) Frame = +1 Query: 169 SSAEAERLPRPEVEVKELSDVPELWRRSRVAWLCKEL 279 + AEA L PEVEV ELS VPE WRR+RVAWLCKEL Sbjct: 73 AEAEARGLRGPEVEVGELSAVPEEWRRARVAWLCKEL 109 >XP_007201413.1 hypothetical protein PRUPE_ppa001679mg [Prunus persica] Length = 781 Score = 55.5 bits (132), Expect = 7e-07 Identities = 26/44 (59%), Positives = 33/44 (75%), Gaps = 2/44 (4%) Frame = +1 Query: 154 FRFDR--SSAEAERLPRPEVEVKELSDVPELWRRSRVAWLCKEL 279 F D+ SSA+ + L PE+EV EL D+PE WRRS++AWLCKEL Sbjct: 97 FNLDKCFSSADLKHLAVPELEVPELEDLPEQWRRSKLAWLCKEL 140 >XP_006349130.1 PREDICTED: pentatricopeptide repeat-containing protein At2g15820, chloroplastic, partial [Solanum tuberosum] Length = 813 Score = 55.5 bits (132), Expect = 7e-07 Identities = 25/44 (56%), Positives = 32/44 (72%), Gaps = 2/44 (4%) Frame = +1 Query: 154 FRFDRS--SAEAERLPRPEVEVKELSDVPELWRRSRVAWLCKEL 279 F FD S S E ++ P VEV+EL D+P+ WRR+R+AWLCKEL Sbjct: 102 FNFDDSFDSVELKKFETPAVEVRELEDIPDQWRRARLAWLCKEL 145 >XP_019066603.1 PREDICTED: pentatricopeptide repeat-containing protein At2g15820, chloroplastic isoform X1 [Solanum lycopersicum] XP_019066604.1 PREDICTED: pentatricopeptide repeat-containing protein At2g15820, chloroplastic isoform X1 [Solanum lycopersicum] Length = 816 Score = 55.5 bits (132), Expect = 7e-07 Identities = 24/44 (54%), Positives = 32/44 (72%), Gaps = 2/44 (4%) Frame = +1 Query: 154 FRFDRS--SAEAERLPRPEVEVKELSDVPELWRRSRVAWLCKEL 279 F FD S S E ++ P +EV+EL D+P+ WRR+R+AWLCKEL Sbjct: 102 FNFDDSFDSVELKKFETPSIEVRELEDIPDQWRRARLAWLCKEL 145 >XP_015874239.1 PREDICTED: pentatricopeptide repeat-containing protein At2g15820, chloroplastic [Ziziphus jujuba] Length = 821 Score = 55.5 bits (132), Expect = 7e-07 Identities = 25/44 (56%), Positives = 34/44 (77%), Gaps = 2/44 (4%) Frame = +1 Query: 154 FRFDRS--SAEAERLPRPEVEVKELSDVPELWRRSRVAWLCKEL 279 F ++RS S + + L PE+EVKEL ++PE WRRS++AWLCKEL Sbjct: 110 FDYERSFASTDLKHLESPELEVKELEELPEQWRRSKLAWLCKEL 153 >KOM55983.1 hypothetical protein LR48_Vigan10g187500 [Vigna angularis] Length = 735 Score = 55.1 bits (131), Expect = 9e-07 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +1 Query: 178 EAERLPRPEVEVKELSDVPELWRRSRVAWLCKEL 279 E+ RL PEVEV ELS VPE WRR+RVAWLCKEL Sbjct: 48 ESRRLRGPEVEVGELSAVPEEWRRARVAWLCKEL 81