BLASTX nr result
ID: Glycyrrhiza30_contig00036849
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00036849 (243 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_012753487.1 conjugal transfer protein TrbA [Methylobacterium ... 99 3e-22 >WP_012753487.1 conjugal transfer protein TrbA [Methylobacterium extorquens] ACS44173.1 Conjugal transfer protein TraA (plasmid) [Methylobacterium extorquens AM1] Length = 964 Score = 98.6 bits (244), Expect = 3e-22 Identities = 52/64 (81%), Positives = 52/64 (81%) Frame = -1 Query: 192 GRFAGLKLGRAPARPMLNATSVEADPAAFLSRAVDGYVXXXXXXXXXXXXDLPVLPHQDK 13 GRFAGLKLGRAPARPMLNATSVEADPAAFLSRAVDGYV DLPVLPHQDK Sbjct: 761 GRFAGLKLGRAPARPMLNATSVEADPAAFLSRAVDGYVAAFADAARMRRADLPVLPHQDK 820 Query: 12 ALAE 1 ALAE Sbjct: 821 ALAE 824