BLASTX nr result
ID: Glycyrrhiza30_contig00036814
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00036814 (241 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_012574775.1 PREDICTED: pentatricopeptide repeat-containing pr... 148 4e-40 XP_007153195.1 hypothetical protein PHAVU_003G014900g [Phaseolus... 142 3e-38 KOM30406.1 hypothetical protein LR48_Vigan1340s000500 [Vigna ang... 142 4e-38 XP_017411469.1 PREDICTED: pentatricopeptide repeat-containing pr... 142 4e-38 XP_014520396.1 PREDICTED: pentatricopeptide repeat-containing pr... 142 4e-38 OIW21103.1 hypothetical protein TanjilG_29318 [Lupinus angustifo... 140 2e-37 XP_013453260.1 PPR containing protein [Medicago truncatula] KEH2... 140 2e-37 XP_019432302.1 PREDICTED: pentatricopeptide repeat-containing pr... 140 2e-37 KHN15470.1 Pentatricopeptide repeat-containing protein [Glycine ... 139 3e-37 KRH70380.1 hypothetical protein GLYMA_02G087100 [Glycine max] 139 3e-37 XP_003520007.1 PREDICTED: pentatricopeptide repeat-containing pr... 139 4e-37 KHN35765.1 Pentatricopeptide repeat-containing protein [Glycine ... 139 6e-37 XP_006583750.1 PREDICTED: pentatricopeptide repeat-containing pr... 139 1e-36 KYP74004.1 Pentatricopeptide repeat-containing protein At1g31430... 136 3e-36 XP_009385828.1 PREDICTED: pentatricopeptide repeat-containing pr... 128 6e-33 XP_015947075.1 PREDICTED: pentatricopeptide repeat-containing pr... 125 5e-32 XP_016181926.1 PREDICTED: pentatricopeptide repeat-containing pr... 125 7e-32 XP_016181924.1 PREDICTED: pentatricopeptide repeat-containing pr... 125 7e-32 XP_010252400.1 PREDICTED: pentatricopeptide repeat-containing pr... 125 1e-31 KGN65409.1 hypothetical protein Csa_1G418260 [Cucumis sativus] 124 2e-31 >XP_012574775.1 PREDICTED: pentatricopeptide repeat-containing protein At1g31430 [Cicer arietinum] XP_012574776.1 PREDICTED: pentatricopeptide repeat-containing protein At1g31430 [Cicer arietinum] XP_012574777.1 PREDICTED: pentatricopeptide repeat-containing protein At1g31430 [Cicer arietinum] XP_012574778.1 PREDICTED: pentatricopeptide repeat-containing protein At1g31430 [Cicer arietinum] XP_012574779.1 PREDICTED: pentatricopeptide repeat-containing protein At1g31430 [Cicer arietinum] XP_012574780.1 PREDICTED: pentatricopeptide repeat-containing protein At1g31430 [Cicer arietinum] XP_012574781.1 PREDICTED: pentatricopeptide repeat-containing protein At1g31430 [Cicer arietinum] XP_012574782.1 PREDICTED: pentatricopeptide repeat-containing protein At1g31430 [Cicer arietinum] Length = 605 Score = 148 bits (373), Expect = 4e-40 Identities = 71/79 (89%), Positives = 75/79 (94%) Frame = -2 Query: 237 KALELFEEMKRFGAKPDDVTFIAVLSACSHAGLVEEGRKLFHSMSNVYHIEPNLEHYGCF 58 KALELFEEMK FGAKPDDVTFI +LSACSHAGLVEEGR+LFHSMS +Y IEPNLEHYGCF Sbjct: 415 KALELFEEMKTFGAKPDDVTFIVLLSACSHAGLVEEGRRLFHSMSCIYDIEPNLEHYGCF 474 Query: 57 IDLLGRAGLLHEAEELIRE 1 IDLLGRAGLLHEAEELIR+ Sbjct: 475 IDLLGRAGLLHEAEELIRK 493 >XP_007153195.1 hypothetical protein PHAVU_003G014900g [Phaseolus vulgaris] ESW25189.1 hypothetical protein PHAVU_003G014900g [Phaseolus vulgaris] Length = 595 Score = 142 bits (359), Expect = 3e-38 Identities = 69/79 (87%), Positives = 74/79 (93%) Frame = -2 Query: 237 KALELFEEMKRFGAKPDDVTFIAVLSACSHAGLVEEGRKLFHSMSNVYHIEPNLEHYGCF 58 KALELFE M+ G KPDDVTFIAVLSAC+HAGLVEEGRKLFHSMS+VYHIEPNLEHYGCF Sbjct: 419 KALELFEAMQVCGFKPDDVTFIAVLSACTHAGLVEEGRKLFHSMSSVYHIEPNLEHYGCF 478 Query: 57 IDLLGRAGLLHEAEELIRE 1 IDLLGRAGLL EAEEL+R+ Sbjct: 479 IDLLGRAGLLQEAEELVRK 497 >KOM30406.1 hypothetical protein LR48_Vigan1340s000500 [Vigna angularis] Length = 580 Score = 142 bits (358), Expect = 4e-38 Identities = 69/78 (88%), Positives = 73/78 (93%) Frame = -2 Query: 237 KALELFEEMKRFGAKPDDVTFIAVLSACSHAGLVEEGRKLFHSMSNVYHIEPNLEHYGCF 58 KALELFE M+ G KPDDVTFIAVLSAC+HAGLVEEGRKLFHSMS+VYHIEPNLEHYGCF Sbjct: 405 KALELFEAMQVCGFKPDDVTFIAVLSACTHAGLVEEGRKLFHSMSSVYHIEPNLEHYGCF 464 Query: 57 IDLLGRAGLLHEAEELIR 4 IDLLGRAGLL EAEEL+R Sbjct: 465 IDLLGRAGLLQEAEELVR 482 >XP_017411469.1 PREDICTED: pentatricopeptide repeat-containing protein At1g31430 [Vigna angularis] BAT98846.1 hypothetical protein VIGAN_10019700 [Vigna angularis var. angularis] Length = 594 Score = 142 bits (358), Expect = 4e-38 Identities = 69/78 (88%), Positives = 73/78 (93%) Frame = -2 Query: 237 KALELFEEMKRFGAKPDDVTFIAVLSACSHAGLVEEGRKLFHSMSNVYHIEPNLEHYGCF 58 KALELFE M+ G KPDDVTFIAVLSAC+HAGLVEEGRKLFHSMS+VYHIEPNLEHYGCF Sbjct: 419 KALELFEAMQVCGFKPDDVTFIAVLSACTHAGLVEEGRKLFHSMSSVYHIEPNLEHYGCF 478 Query: 57 IDLLGRAGLLHEAEELIR 4 IDLLGRAGLL EAEEL+R Sbjct: 479 IDLLGRAGLLQEAEELVR 496 >XP_014520396.1 PREDICTED: pentatricopeptide repeat-containing protein At1g31430 [Vigna radiata var. radiata] Length = 599 Score = 142 bits (358), Expect = 4e-38 Identities = 69/78 (88%), Positives = 73/78 (93%) Frame = -2 Query: 237 KALELFEEMKRFGAKPDDVTFIAVLSACSHAGLVEEGRKLFHSMSNVYHIEPNLEHYGCF 58 KALELFE M+ G KPDDVTFIAVLSAC+HAGLVEEGRKLFHSMS+VYHIEPNLEHYGCF Sbjct: 424 KALELFEAMQVCGFKPDDVTFIAVLSACTHAGLVEEGRKLFHSMSSVYHIEPNLEHYGCF 483 Query: 57 IDLLGRAGLLHEAEELIR 4 IDLLGRAGLL EAEEL+R Sbjct: 484 IDLLGRAGLLQEAEELVR 501 >OIW21103.1 hypothetical protein TanjilG_29318 [Lupinus angustifolius] Length = 559 Score = 140 bits (353), Expect = 2e-37 Identities = 66/79 (83%), Positives = 74/79 (93%) Frame = -2 Query: 237 KALELFEEMKRFGAKPDDVTFIAVLSACSHAGLVEEGRKLFHSMSNVYHIEPNLEHYGCF 58 KALELFEEM+ FGA+PDD TFIA+LSACSH GLVEEGRKLF+SMS Y+IEPNL+HYGCF Sbjct: 390 KALELFEEMETFGARPDDGTFIAILSACSHGGLVEEGRKLFYSMSRKYNIEPNLKHYGCF 449 Query: 57 IDLLGRAGLLHEAEELIRE 1 IDLLGRAGLLHEAEEL+R+ Sbjct: 450 IDLLGRAGLLHEAEELVRK 468 >XP_013453260.1 PPR containing protein [Medicago truncatula] KEH27289.1 PPR containing protein [Medicago truncatula] Length = 608 Score = 140 bits (354), Expect = 2e-37 Identities = 67/79 (84%), Positives = 73/79 (92%) Frame = -2 Query: 237 KALELFEEMKRFGAKPDDVTFIAVLSACSHAGLVEEGRKLFHSMSNVYHIEPNLEHYGCF 58 +ALELFEEMK FGAKPDDVTFI +L+ACSH GLVEEG KLFHSMS +Y IEPNLEHYGCF Sbjct: 421 EALELFEEMKIFGAKPDDVTFIVLLNACSHGGLVEEGHKLFHSMSCIYGIEPNLEHYGCF 480 Query: 57 IDLLGRAGLLHEAEELIRE 1 IDLLGRAGLLHEAEELI++ Sbjct: 481 IDLLGRAGLLHEAEELIKK 499 >XP_019432302.1 PREDICTED: pentatricopeptide repeat-containing protein At1g31430 [Lupinus angustifolius] Length = 586 Score = 140 bits (353), Expect = 2e-37 Identities = 66/79 (83%), Positives = 74/79 (93%) Frame = -2 Query: 237 KALELFEEMKRFGAKPDDVTFIAVLSACSHAGLVEEGRKLFHSMSNVYHIEPNLEHYGCF 58 KALELFEEM+ FGA+PDD TFIA+LSACSH GLVEEGRKLF+SMS Y+IEPNL+HYGCF Sbjct: 417 KALELFEEMETFGARPDDGTFIAILSACSHGGLVEEGRKLFYSMSRKYNIEPNLKHYGCF 476 Query: 57 IDLLGRAGLLHEAEELIRE 1 IDLLGRAGLLHEAEEL+R+ Sbjct: 477 IDLLGRAGLLHEAEELVRK 495 >KHN15470.1 Pentatricopeptide repeat-containing protein [Glycine soja] Length = 545 Score = 139 bits (351), Expect = 3e-37 Identities = 64/79 (81%), Positives = 73/79 (92%) Frame = -2 Query: 237 KALELFEEMKRFGAKPDDVTFIAVLSACSHAGLVEEGRKLFHSMSNVYHIEPNLEHYGCF 58 +ALELFE M+ G KPDD+TF+AVLSAC HAGLVEEGRKLFHSMS++YHIEPNLEHYGCF Sbjct: 379 EALELFEAMQTCGLKPDDITFVAVLSACGHAGLVEEGRKLFHSMSSIYHIEPNLEHYGCF 438 Query: 57 IDLLGRAGLLHEAEELIRE 1 IDLLGRAGLL EAEEL+++ Sbjct: 439 IDLLGRAGLLQEAEELVKK 457 >KRH70380.1 hypothetical protein GLYMA_02G087100 [Glycine max] Length = 571 Score = 139 bits (351), Expect = 3e-37 Identities = 64/79 (81%), Positives = 73/79 (92%) Frame = -2 Query: 237 KALELFEEMKRFGAKPDDVTFIAVLSACSHAGLVEEGRKLFHSMSNVYHIEPNLEHYGCF 58 +ALELFE M+ G KPDD+TF+AVLSAC HAGLVEEGRKLFHSMS++YHIEPNLEHYGCF Sbjct: 405 EALELFEAMQTCGLKPDDITFVAVLSACGHAGLVEEGRKLFHSMSSIYHIEPNLEHYGCF 464 Query: 57 IDLLGRAGLLHEAEELIRE 1 IDLLGRAGLL EAEEL+++ Sbjct: 465 IDLLGRAGLLQEAEELVKK 483 >XP_003520007.1 PREDICTED: pentatricopeptide repeat-containing protein At1g31430-like [Glycine max] Length = 591 Score = 139 bits (351), Expect = 4e-37 Identities = 64/79 (81%), Positives = 73/79 (92%) Frame = -2 Query: 237 KALELFEEMKRFGAKPDDVTFIAVLSACSHAGLVEEGRKLFHSMSNVYHIEPNLEHYGCF 58 +ALELFE M+ G KPDD+TF+AVLSAC HAGLVEEGRKLFHSMS++YHIEPNLEHYGCF Sbjct: 425 EALELFEAMQTCGLKPDDITFVAVLSACGHAGLVEEGRKLFHSMSSIYHIEPNLEHYGCF 484 Query: 57 IDLLGRAGLLHEAEELIRE 1 IDLLGRAGLL EAEEL+++ Sbjct: 485 IDLLGRAGLLQEAEELVKK 503 >KHN35765.1 Pentatricopeptide repeat-containing protein [Glycine soja] Length = 568 Score = 139 bits (349), Expect = 6e-37 Identities = 64/79 (81%), Positives = 74/79 (93%) Frame = -2 Query: 237 KALELFEEMKRFGAKPDDVTFIAVLSACSHAGLVEEGRKLFHSMSNVYHIEPNLEHYGCF 58 +ALELF+ M+ G KPDD+TF+AVLSACSHAGLVEEGRKLFHSMS++YHIEPNLEHYGCF Sbjct: 379 EALELFKAMQTCGLKPDDITFVAVLSACSHAGLVEEGRKLFHSMSSMYHIEPNLEHYGCF 438 Query: 57 IDLLGRAGLLHEAEELIRE 1 IDLLGRAGLL EAEEL+++ Sbjct: 439 IDLLGRAGLLQEAEELVKK 457 >XP_006583750.1 PREDICTED: pentatricopeptide repeat-containing protein At1g31430-like [Glycine max] KRH49706.1 hypothetical protein GLYMA_07G173900 [Glycine max] KRH49707.1 hypothetical protein GLYMA_07G173900 [Glycine max] Length = 621 Score = 139 bits (349), Expect = 1e-36 Identities = 64/79 (81%), Positives = 74/79 (93%) Frame = -2 Query: 237 KALELFEEMKRFGAKPDDVTFIAVLSACSHAGLVEEGRKLFHSMSNVYHIEPNLEHYGCF 58 +ALELF+ M+ G KPDD+TF+AVLSACSHAGLVEEGRKLFHSMS++YHIEPNLEHYGCF Sbjct: 432 EALELFKAMQTCGLKPDDITFVAVLSACSHAGLVEEGRKLFHSMSSMYHIEPNLEHYGCF 491 Query: 57 IDLLGRAGLLHEAEELIRE 1 IDLLGRAGLL EAEEL+++ Sbjct: 492 IDLLGRAGLLQEAEELVKK 510 >KYP74004.1 Pentatricopeptide repeat-containing protein At1g31430 family [Cajanus cajan] Length = 509 Score = 136 bits (343), Expect = 3e-36 Identities = 64/79 (81%), Positives = 73/79 (92%) Frame = -2 Query: 237 KALELFEEMKRFGAKPDDVTFIAVLSACSHAGLVEEGRKLFHSMSNVYHIEPNLEHYGCF 58 +ALELFE M+ G KPDDVTFIAVLSACSHAGLVEEGRKLFHSMS++YHIEPNLEHYGCF Sbjct: 316 EALELFEAMQTCGLKPDDVTFIAVLSACSHAGLVEEGRKLFHSMSSIYHIEPNLEHYGCF 375 Query: 57 IDLLGRAGLLHEAEELIRE 1 IDLL +AGLL EA+EL+++ Sbjct: 376 IDLLNQAGLLQEAKELVKK 394 >XP_009385828.1 PREDICTED: pentatricopeptide repeat-containing protein At1g31430 [Musa acuminata subsp. malaccensis] XP_018676832.1 PREDICTED: pentatricopeptide repeat-containing protein At1g31430 [Musa acuminata subsp. malaccensis] XP_018676833.1 PREDICTED: pentatricopeptide repeat-containing protein At1g31430 [Musa acuminata subsp. malaccensis] Length = 647 Score = 128 bits (322), Expect = 6e-33 Identities = 60/78 (76%), Positives = 67/78 (85%) Frame = -2 Query: 237 KALELFEEMKRFGAKPDDVTFIAVLSACSHAGLVEEGRKLFHSMSNVYHIEPNLEHYGCF 58 KALELF EM+R GAKPDD+TFI+VLSACSH GLV EGR+ FH+M +Y +EP LEHYGCF Sbjct: 465 KALELFSEMRRAGAKPDDITFISVLSACSHGGLVNEGRRFFHAMKEMYRMEPKLEHYGCF 524 Query: 57 IDLLGRAGLLHEAEELIR 4 IDLLGRAGLL EAE LIR Sbjct: 525 IDLLGRAGLLDEAEGLIR 542 >XP_015947075.1 PREDICTED: pentatricopeptide repeat-containing protein At1g31430 [Arachis duranensis] Length = 612 Score = 125 bits (315), Expect = 5e-32 Identities = 59/79 (74%), Positives = 66/79 (83%) Frame = -2 Query: 237 KALELFEEMKRFGAKPDDVTFIAVLSACSHAGLVEEGRKLFHSMSNVYHIEPNLEHYGCF 58 KALELFE M FGA+PD +TFIAVLSAC H GLVEEGRK FHSM +Y +EP L HYGCF Sbjct: 427 KALELFEAMVTFGARPDGITFIAVLSACCHGGLVEEGRKYFHSMKRIYLVEPKLVHYGCF 486 Query: 57 IDLLGRAGLLHEAEELIRE 1 +DLLGRAGLL EAEELI++ Sbjct: 487 VDLLGRAGLLDEAEELIKK 505 >XP_016181926.1 PREDICTED: pentatricopeptide repeat-containing protein At1g31430 isoform X2 [Arachis ipaensis] Length = 604 Score = 125 bits (314), Expect = 7e-32 Identities = 59/79 (74%), Positives = 66/79 (83%) Frame = -2 Query: 237 KALELFEEMKRFGAKPDDVTFIAVLSACSHAGLVEEGRKLFHSMSNVYHIEPNLEHYGCF 58 KALELFE M FGA+PD +TFIAVLSAC H GLVEEGRK FHSM +Y +EP L HYGCF Sbjct: 419 KALELFEAMITFGARPDGITFIAVLSACCHGGLVEEGRKYFHSMKRIYLVEPKLVHYGCF 478 Query: 57 IDLLGRAGLLHEAEELIRE 1 +DLLGRAGLL EAEELI++ Sbjct: 479 VDLLGRAGLLDEAEELIKK 497 >XP_016181924.1 PREDICTED: pentatricopeptide repeat-containing protein At1g31430 isoform X1 [Arachis ipaensis] XP_016181925.1 PREDICTED: pentatricopeptide repeat-containing protein At1g31430 isoform X1 [Arachis ipaensis] Length = 613 Score = 125 bits (314), Expect = 7e-32 Identities = 59/79 (74%), Positives = 66/79 (83%) Frame = -2 Query: 237 KALELFEEMKRFGAKPDDVTFIAVLSACSHAGLVEEGRKLFHSMSNVYHIEPNLEHYGCF 58 KALELFE M FGA+PD +TFIAVLSAC H GLVEEGRK FHSM +Y +EP L HYGCF Sbjct: 428 KALELFEAMITFGARPDGITFIAVLSACCHGGLVEEGRKYFHSMKRIYLVEPKLVHYGCF 487 Query: 57 IDLLGRAGLLHEAEELIRE 1 +DLLGRAGLL EAEELI++ Sbjct: 488 VDLLGRAGLLDEAEELIKK 506 >XP_010252400.1 PREDICTED: pentatricopeptide repeat-containing protein At1g31430 [Nelumbo nucifera] XP_019052666.1 PREDICTED: pentatricopeptide repeat-containing protein At1g31430 [Nelumbo nucifera] XP_019052667.1 PREDICTED: pentatricopeptide repeat-containing protein At1g31430 [Nelumbo nucifera] XP_019052668.1 PREDICTED: pentatricopeptide repeat-containing protein At1g31430 [Nelumbo nucifera] Length = 661 Score = 125 bits (313), Expect = 1e-31 Identities = 60/79 (75%), Positives = 65/79 (82%) Frame = -2 Query: 237 KALELFEEMKRFGAKPDDVTFIAVLSACSHAGLVEEGRKLFHSMSNVYHIEPNLEHYGCF 58 KALELF EMK G KPDD+TFI VLSACSH GLVEEGR+ F SM +Y IEP LEHYGCF Sbjct: 448 KALELFSEMKLVGVKPDDITFIGVLSACSHGGLVEEGRRHFDSMRKLYQIEPKLEHYGCF 507 Query: 57 IDLLGRAGLLHEAEELIRE 1 IDLLGRAGLL+EAEE I + Sbjct: 508 IDLLGRAGLLNEAEEFIEK 526 >KGN65409.1 hypothetical protein Csa_1G418260 [Cucumis sativus] Length = 811 Score = 124 bits (312), Expect = 2e-31 Identities = 59/79 (74%), Positives = 67/79 (84%) Frame = -2 Query: 237 KALELFEEMKRFGAKPDDVTFIAVLSACSHAGLVEEGRKLFHSMSNVYHIEPNLEHYGCF 58 +AL LF EM+R GAKPDD+TFI VLSACSH GLVEEGR+ F+SM V+ IEP +EHYGC Sbjct: 590 EALRLFSEMERVGAKPDDITFIGVLSACSHGGLVEEGRRFFNSMKKVHRIEPKVEHYGCV 649 Query: 57 IDLLGRAGLLHEAEELIRE 1 IDLLGRAGLL EAEELI+E Sbjct: 650 IDLLGRAGLLDEAEELIQE 668