BLASTX nr result
ID: Glycyrrhiza30_contig00036458
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00036458 (285 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KYP74136.1 hypothetical protein KK1_006804 [Cajanus cajan] 60 1e-09 KHN05880.1 hypothetical protein glysoja_026468 [Glycine soja] 59 2e-09 NP_001238479.1 uncharacterized protein LOC100305902 [Glycine max... 59 2e-09 KHN48938.1 hypothetical protein glysoja_025315 [Glycine soja] KR... 57 1e-08 XP_007144857.1 hypothetical protein PHAVU_007G190000g [Phaseolus... 57 1e-08 >KYP74136.1 hypothetical protein KK1_006804 [Cajanus cajan] Length = 96 Score = 59.7 bits (143), Expect = 1e-09 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = +2 Query: 182 MKISRLHSFQRNQFMKFQRKTRVTSSVTLGNVQR 283 MK+SR++SFQR QFMKF RKTRVTSSVTLG+VQR Sbjct: 1 MKVSRVYSFQRTQFMKFHRKTRVTSSVTLGSVQR 34 >KHN05880.1 hypothetical protein glysoja_026468 [Glycine soja] Length = 97 Score = 58.9 bits (141), Expect = 2e-09 Identities = 27/34 (79%), Positives = 33/34 (97%) Frame = +2 Query: 182 MKISRLHSFQRNQFMKFQRKTRVTSSVTLGNVQR 283 MK+S+++SFQR+QFMKF RKTRVTSSVTLG+VQR Sbjct: 1 MKVSKVYSFQRDQFMKFHRKTRVTSSVTLGSVQR 34 >NP_001238479.1 uncharacterized protein LOC100305902 [Glycine max] ACU13812.1 unknown [Glycine max] KRH32243.1 hypothetical protein GLYMA_10G039800 [Glycine max] Length = 97 Score = 58.9 bits (141), Expect = 2e-09 Identities = 27/34 (79%), Positives = 33/34 (97%) Frame = +2 Query: 182 MKISRLHSFQRNQFMKFQRKTRVTSSVTLGNVQR 283 MK+S+++SFQR+QFMKF RKTRVTSSVTLG+VQR Sbjct: 1 MKVSKVYSFQRDQFMKFHRKTRVTSSVTLGSVQR 34 >KHN48938.1 hypothetical protein glysoja_025315 [Glycine soja] KRH19613.1 hypothetical protein GLYMA_13G126300 [Glycine max] Length = 100 Score = 57.4 bits (137), Expect = 1e-08 Identities = 26/34 (76%), Positives = 32/34 (94%) Frame = +2 Query: 182 MKISRLHSFQRNQFMKFQRKTRVTSSVTLGNVQR 283 MK+SR++ FQR+QFMKF RKTR+TSSVTLG+VQR Sbjct: 1 MKVSRVYGFQRDQFMKFHRKTRLTSSVTLGSVQR 34 >XP_007144857.1 hypothetical protein PHAVU_007G190000g [Phaseolus vulgaris] ESW16851.1 hypothetical protein PHAVU_007G190000g [Phaseolus vulgaris] Length = 96 Score = 57.0 bits (136), Expect = 1e-08 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = +2 Query: 182 MKISRLHSFQRNQFMKFQRKTRVTSSVTLGNVQR 283 MK+SR++SFQR+QFMKF KTRVTSSVTLG+VQR Sbjct: 1 MKVSRVYSFQRDQFMKFHWKTRVTSSVTLGSVQR 34