BLASTX nr result
ID: Glycyrrhiza30_contig00035543
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00035543 (273 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU12069.1 hypothetical protein TSUD_00350 [Trifolium subterraneum] 57 1e-07 XP_015942249.1 PREDICTED: inositol transporter 1-like [Arachis d... 56 3e-07 XP_016174076.1 PREDICTED: inositol transporter 1-like [Arachis i... 56 3e-07 GAU42062.1 hypothetical protein TSUD_326400 [Trifolium subterran... 56 4e-07 XP_003601664.2 sugar porter (SP) family MFS transporter [Medicag... 56 4e-07 XP_017408943.1 PREDICTED: inositol transporter 1-like [Vigna ang... 56 4e-07 XP_014498161.1 PREDICTED: inositol transporter 1-like [Vigna rad... 56 4e-07 XP_007139108.1 hypothetical protein PHAVU_008G002000g [Phaseolus... 56 4e-07 XP_016194827.1 PREDICTED: inositol transporter 1-like [Arachis i... 56 4e-07 XP_015962900.1 PREDICTED: inositol transporter 1-like [Arachis d... 56 4e-07 XP_003532323.1 PREDICTED: inositol transporter 1 [Glycine max] K... 56 4e-07 XP_004502238.1 PREDICTED: inositol transporter 1-like [Cicer ari... 55 6e-07 XP_004515584.1 PREDICTED: inositol transporter 1-like [Cicer ari... 54 2e-06 XP_003592843.1 sugar porter (SP) family MFS transporter [Medicag... 54 2e-06 KOM28465.1 hypothetical protein LR48_Vigan549s002000 [Vigna angu... 54 3e-06 XP_016181645.1 PREDICTED: inositol transporter 1-like [Arachis i... 54 3e-06 XP_015944165.1 PREDICTED: inositol transporter 1-like [Arachis d... 54 3e-06 XP_019426989.1 PREDICTED: inositol transporter 1-like [Lupinus a... 54 3e-06 XP_018806487.1 PREDICTED: inositol transporter 1 isoform X1 [Jug... 53 4e-06 ACJ85844.1 unknown, partial [Medicago truncatula] 52 6e-06 >GAU12069.1 hypothetical protein TSUD_00350 [Trifolium subterraneum] Length = 524 Score = 57.4 bits (137), Expect = 1e-07 Identities = 25/40 (62%), Positives = 31/40 (77%) Frame = +2 Query: 152 MVQTNSHTNRMTMEATPGSSDYLEMYPERKISFFKNPYIL 271 M TN T T+++ PGSS YL++YPERK+SFFKNPYIL Sbjct: 1 MADTNLITTSTTIQSAPGSSGYLDLYPERKMSFFKNPYIL 40 >XP_015942249.1 PREDICTED: inositol transporter 1-like [Arachis duranensis] Length = 487 Score = 56.2 bits (134), Expect = 3e-07 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = +2 Query: 182 MTMEATPGSSDYLEMYPERKISFFKNPYIL 271 MTM++TPGSS YL++YP+RK+SFFKNPYIL Sbjct: 1 MTMQSTPGSSGYLDLYPDRKMSFFKNPYIL 30 >XP_016174076.1 PREDICTED: inositol transporter 1-like [Arachis ipaensis] Length = 492 Score = 56.2 bits (134), Expect = 3e-07 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = +2 Query: 182 MTMEATPGSSDYLEMYPERKISFFKNPYIL 271 MTM++TPGSS YL++YP+RK+SFFKNPYIL Sbjct: 1 MTMQSTPGSSGYLDLYPDRKMSFFKNPYIL 30 >GAU42062.1 hypothetical protein TSUD_326400 [Trifolium subterraneum] Length = 486 Score = 55.8 bits (133), Expect = 4e-07 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = +2 Query: 194 ATPGSSDYLEMYPERKISFFKNPYIL 271 ATPGSSDYLE+YPERKIS+FKNPYIL Sbjct: 2 ATPGSSDYLELYPERKISYFKNPYIL 27 >XP_003601664.2 sugar porter (SP) family MFS transporter [Medicago truncatula] AES71915.2 sugar porter (SP) family MFS transporter [Medicago truncatula] Length = 496 Score = 55.8 bits (133), Expect = 4e-07 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = +2 Query: 194 ATPGSSDYLEMYPERKISFFKNPYIL 271 ATPGSSDYLE+YPERKIS+FKNPYIL Sbjct: 4 ATPGSSDYLELYPERKISYFKNPYIL 29 >XP_017408943.1 PREDICTED: inositol transporter 1-like [Vigna angularis] BAT82940.1 hypothetical protein VIGAN_04002600 [Vigna angularis var. angularis] Length = 498 Score = 55.8 bits (133), Expect = 4e-07 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = +2 Query: 182 MTMEATPGSSDYLEMYPERKISFFKNPYIL 271 +TM++TPGSS YL++YPERK+SFFKNPYIL Sbjct: 3 ITMQSTPGSSGYLDLYPERKMSFFKNPYIL 32 >XP_014498161.1 PREDICTED: inositol transporter 1-like [Vigna radiata var. radiata] Length = 498 Score = 55.8 bits (133), Expect = 4e-07 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = +2 Query: 182 MTMEATPGSSDYLEMYPERKISFFKNPYIL 271 +TM++TPGSS YL++YPERK+SFFKNPYIL Sbjct: 3 ITMQSTPGSSGYLDLYPERKMSFFKNPYIL 32 >XP_007139108.1 hypothetical protein PHAVU_008G002000g [Phaseolus vulgaris] ESW11102.1 hypothetical protein PHAVU_008G002000g [Phaseolus vulgaris] Length = 498 Score = 55.8 bits (133), Expect = 4e-07 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = +2 Query: 182 MTMEATPGSSDYLEMYPERKISFFKNPYIL 271 +TM++TPGSS YL++YPERK+SFFKNPYIL Sbjct: 3 ITMQSTPGSSGYLDLYPERKMSFFKNPYIL 32 >XP_016194827.1 PREDICTED: inositol transporter 1-like [Arachis ipaensis] Length = 500 Score = 55.8 bits (133), Expect = 4e-07 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = +2 Query: 182 MTMEATPGSSDYLEMYPERKISFFKNPYIL 271 +TM++TPGSS YL++YPERK+SFFKNPYIL Sbjct: 3 ITMQSTPGSSGYLDLYPERKMSFFKNPYIL 32 >XP_015962900.1 PREDICTED: inositol transporter 1-like [Arachis duranensis] Length = 500 Score = 55.8 bits (133), Expect = 4e-07 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = +2 Query: 182 MTMEATPGSSDYLEMYPERKISFFKNPYIL 271 +TM++TPGSS YL++YPERK+SFFKNPYIL Sbjct: 3 ITMQSTPGSSGYLDLYPERKMSFFKNPYIL 32 >XP_003532323.1 PREDICTED: inositol transporter 1 [Glycine max] KHN24968.1 Putative inositol transporter 1 [Glycine soja] KRH46867.1 hypothetical protein GLYMA_08G361200 [Glycine max] Length = 501 Score = 55.8 bits (133), Expect = 4e-07 Identities = 23/30 (76%), Positives = 29/30 (96%) Frame = +2 Query: 182 MTMEATPGSSDYLEMYPERKISFFKNPYIL 271 +TM++TPGSS YL++YPERK+SFFKNPYIL Sbjct: 6 ITMQSTPGSSGYLDLYPERKMSFFKNPYIL 35 >XP_004502238.1 PREDICTED: inositol transporter 1-like [Cicer arietinum] Length = 495 Score = 55.5 bits (132), Expect = 6e-07 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = +2 Query: 188 MEATPGSSDYLEMYPERKISFFKNPYIL 271 M+ATPGSS YLE+YPERKIS+FKNPYIL Sbjct: 1 MKATPGSSGYLELYPERKISYFKNPYIL 28 >XP_004515584.1 PREDICTED: inositol transporter 1-like [Cicer arietinum] Length = 498 Score = 53.9 bits (128), Expect = 2e-06 Identities = 22/30 (73%), Positives = 29/30 (96%) Frame = +2 Query: 182 MTMEATPGSSDYLEMYPERKISFFKNPYIL 271 +TM++TPGSS YL+++PERK+SFFKNPYIL Sbjct: 3 ITMQSTPGSSGYLDLHPERKMSFFKNPYIL 32 >XP_003592843.1 sugar porter (SP) family MFS transporter [Medicago truncatula] AES63094.1 sugar porter (SP) family MFS transporter [Medicago truncatula] Length = 508 Score = 53.9 bits (128), Expect = 2e-06 Identities = 22/35 (62%), Positives = 31/35 (88%) Frame = +2 Query: 167 SHTNRMTMEATPGSSDYLEMYPERKISFFKNPYIL 271 ++T+ +++TPGSS YL++YPERK+SFFKNPYIL Sbjct: 2 TNTSSTMVQSTPGSSGYLDLYPERKMSFFKNPYIL 36 >KOM28465.1 hypothetical protein LR48_Vigan549s002000 [Vigna angularis] Length = 494 Score = 53.5 bits (127), Expect = 3e-06 Identities = 22/28 (78%), Positives = 27/28 (96%) Frame = +2 Query: 188 MEATPGSSDYLEMYPERKISFFKNPYIL 271 M++TPGSS YL++YPERK+SFFKNPYIL Sbjct: 1 MQSTPGSSGYLDLYPERKMSFFKNPYIL 28 >XP_016181645.1 PREDICTED: inositol transporter 1-like [Arachis ipaensis] Length = 500 Score = 53.5 bits (127), Expect = 3e-06 Identities = 22/30 (73%), Positives = 28/30 (93%) Frame = +2 Query: 182 MTMEATPGSSDYLEMYPERKISFFKNPYIL 271 +TM +TPGSS YL++YPERK+SFFKNP+IL Sbjct: 3 ITMHSTPGSSGYLDLYPERKMSFFKNPFIL 32 >XP_015944165.1 PREDICTED: inositol transporter 1-like [Arachis duranensis] Length = 500 Score = 53.5 bits (127), Expect = 3e-06 Identities = 22/30 (73%), Positives = 28/30 (93%) Frame = +2 Query: 182 MTMEATPGSSDYLEMYPERKISFFKNPYIL 271 +TM +TPGSS YL++YPERK+SFFKNP+IL Sbjct: 3 ITMHSTPGSSGYLDLYPERKMSFFKNPFIL 32 >XP_019426989.1 PREDICTED: inositol transporter 1-like [Lupinus angustifolius] Length = 501 Score = 53.5 bits (127), Expect = 3e-06 Identities = 21/29 (72%), Positives = 28/29 (96%) Frame = +2 Query: 185 TMEATPGSSDYLEMYPERKISFFKNPYIL 271 T+++TPGSS YL++YP+RK+SFFKNPYIL Sbjct: 8 TIQSTPGSSGYLDLYPDRKVSFFKNPYIL 36 >XP_018806487.1 PREDICTED: inositol transporter 1 isoform X1 [Juglans regia] Length = 498 Score = 53.1 bits (126), Expect = 4e-06 Identities = 21/30 (70%), Positives = 28/30 (93%) Frame = +2 Query: 182 MTMEATPGSSDYLEMYPERKISFFKNPYIL 271 MT+E+ PGSS YL++YPERK+S+FKNPY+L Sbjct: 1 MTIESLPGSSGYLDLYPERKMSYFKNPYVL 30 >ACJ85844.1 unknown, partial [Medicago truncatula] Length = 216 Score = 52.0 bits (123), Expect = 6e-06 Identities = 21/30 (70%), Positives = 28/30 (93%) Frame = +2 Query: 182 MTMEATPGSSDYLEMYPERKISFFKNPYIL 271 + M++TPGSS YL+M+P+RK+SFFKNPYIL Sbjct: 5 IAMQSTPGSSGYLDMHPDRKMSFFKNPYIL 34