BLASTX nr result
ID: Glycyrrhiza30_contig00035496
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00035496 (214 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value WP_029083529.1 MULTISPECIES: 30S ribosomal protein S6 [Bradyrhiz... 69 6e-13 WP_028335160.1 MULTISPECIES: 30S ribosomal protein S6 [Bradyrhiz... 69 6e-13 SEB78555.1 SSU ribosomal protein S6P [Bradyrhizobium erythrophlei] 69 6e-13 WP_050406442.1 30S ribosomal protein S6 [Bradyrhizobium embrapense] 69 6e-13 WP_026192679.1 MULTISPECIES: 30S ribosomal protein S6 [Bradyrhiz... 69 6e-13 WP_021079846.1 MULTISPECIES: 30S ribosomal protein S6 [Bradyrhiz... 69 6e-13 WP_024581463.1 MULTISPECIES: 30S ribosomal protein S6 [Bradyrhiz... 69 6e-13 WP_028165054.1 30S ribosomal protein S6 [Bradyrhizobium elkanii] 66 5e-12 WP_066498586.1 30S ribosomal protein S6 [Bradyrhizobium sp. BR 1... 65 1e-11 WP_072825350.1 30S ribosomal protein S6 [Bradyrhizobium erythrop... 65 2e-11 WP_044536454.1 MULTISPECIES: 30S ribosomal protein S6 [Bradyrhiz... 64 4e-11 SHH14284.1 SSU ribosomal protein S6P [Bradyrhizobium erythrophlei] 63 8e-11 SHG99495.1 SSU ribosomal protein S6P [Bradyrhizobium erythrophlei] 63 8e-11 SDS35141.1 SSU ribosomal protein S6P [Bradyrhizobium canariense] 63 8e-11 WP_029583670.1 30S ribosomal protein S6 [Bradyrhizobium sp. URHD... 63 8e-11 WP_035656597.1 30S ribosomal protein S6 [Bradyrhizobium sp. STM ... 63 1e-10 WP_008969613.1 30S ribosomal protein S6 [Bradyrhizobium sp. STM ... 63 1e-10 WP_006610960.1 30S ribosomal protein S6 [Bradyrhizobium sp. ORS ... 63 1e-10 WP_027583810.1 30S ribosomal protein S6 [Bradyrhizobium sp. Ai1a-2] 62 3e-10 WP_011926260.1 MULTISPECIES: 30S ribosomal protein S6 [Bradyrhiz... 61 4e-10 >WP_029083529.1 MULTISPECIES: 30S ribosomal protein S6 [Bradyrhizobium] KRP87927.1 30S ribosomal protein S6 [Bradyrhizobium pachyrhizi] OKO81071.1 30S ribosomal protein S6 [Bradyrhizobium sp. NAS96.2] Length = 154 Score = 68.6 bits (166), Expect = 6e-13 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -1 Query: 100 MPLYEHVFLARQDASTQQVDELTAQMTGIVEQG 2 MPLYEHVFLARQDASTQQVDELTAQMTGIVEQG Sbjct: 1 MPLYEHVFLARQDASTQQVDELTAQMTGIVEQG 33 >WP_028335160.1 MULTISPECIES: 30S ribosomal protein S6 [Bradyrhizobium] OIM90921.1 30S ribosomal protein S6 [Bradyrhizobium elkanii] Length = 154 Score = 68.6 bits (166), Expect = 6e-13 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -1 Query: 100 MPLYEHVFLARQDASTQQVDELTAQMTGIVEQG 2 MPLYEHVFLARQDASTQQVDELTAQMTGIVEQG Sbjct: 1 MPLYEHVFLARQDASTQQVDELTAQMTGIVEQG 33 >SEB78555.1 SSU ribosomal protein S6P [Bradyrhizobium erythrophlei] Length = 155 Score = 68.6 bits (166), Expect = 6e-13 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -1 Query: 100 MPLYEHVFLARQDASTQQVDELTAQMTGIVEQG 2 MPLYEHVFLARQDASTQQVDELTAQMTGIVEQG Sbjct: 1 MPLYEHVFLARQDASTQQVDELTAQMTGIVEQG 33 >WP_050406442.1 30S ribosomal protein S6 [Bradyrhizobium embrapense] Length = 155 Score = 68.6 bits (166), Expect = 6e-13 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -1 Query: 100 MPLYEHVFLARQDASTQQVDELTAQMTGIVEQG 2 MPLYEHVFLARQDASTQQVDELTAQMTGIVEQG Sbjct: 1 MPLYEHVFLARQDASTQQVDELTAQMTGIVEQG 33 >WP_026192679.1 MULTISPECIES: 30S ribosomal protein S6 [Bradyrhizobium] ODM78161.1 30S ribosomal protein S6 [Bradyrhizobium elkanii] ODM78883.1 30S ribosomal protein S6 [Bradyrhizobium elkanii] SDE97233.1 SSU ribosomal protein S6P [Bradyrhizobium sp. R5] OMI03078.1 30S ribosomal protein S6 [Bradyrhizobium sp. UFLA 03-321] Length = 155 Score = 68.6 bits (166), Expect = 6e-13 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -1 Query: 100 MPLYEHVFLARQDASTQQVDELTAQMTGIVEQG 2 MPLYEHVFLARQDASTQQVDELTAQMTGIVEQG Sbjct: 1 MPLYEHVFLARQDASTQQVDELTAQMTGIVEQG 33 >WP_021079846.1 MULTISPECIES: 30S ribosomal protein S6 [Bradyrhizobium] ERF81278.1 30S ribosomal protein S6 [Bradyrhizobium sp. DFCI-1] Length = 155 Score = 68.6 bits (166), Expect = 6e-13 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -1 Query: 100 MPLYEHVFLARQDASTQQVDELTAQMTGIVEQG 2 MPLYEHVFLARQDASTQQVDELTAQMTGIVEQG Sbjct: 1 MPLYEHVFLARQDASTQQVDELTAQMTGIVEQG 33 >WP_024581463.1 MULTISPECIES: 30S ribosomal protein S6 [Bradyrhizobium] KIU45920.1 30S ribosomal protein S6 [Bradyrhizobium elkanii] OCX27049.1 30S ribosomal protein S6 [Bradyrhizobium sp. UASWS1016] Length = 156 Score = 68.6 bits (166), Expect = 6e-13 Identities = 33/33 (100%), Positives = 33/33 (100%) Frame = -1 Query: 100 MPLYEHVFLARQDASTQQVDELTAQMTGIVEQG 2 MPLYEHVFLARQDASTQQVDELTAQMTGIVEQG Sbjct: 1 MPLYEHVFLARQDASTQQVDELTAQMTGIVEQG 33 >WP_028165054.1 30S ribosomal protein S6 [Bradyrhizobium elkanii] Length = 156 Score = 66.2 bits (160), Expect = 5e-12 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 100 MPLYEHVFLARQDASTQQVDELTAQMTGIVEQ 5 MPLYEHVFLARQDASTQQVDELTAQMTGIVEQ Sbjct: 1 MPLYEHVFLARQDASTQQVDELTAQMTGIVEQ 32 >WP_066498586.1 30S ribosomal protein S6 [Bradyrhizobium sp. BR 10303] KWV61169.1 30S ribosomal protein S6 [Bradyrhizobium sp. BR 10303] Length = 157 Score = 65.5 bits (158), Expect = 1e-11 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -1 Query: 100 MPLYEHVFLARQDASTQQVDELTAQMTGIVEQG 2 MPLYEHVFLARQDASTQQVDELTAQ++GIVEQG Sbjct: 1 MPLYEHVFLARQDASTQQVDELTAQVSGIVEQG 33 >WP_072825350.1 30S ribosomal protein S6 [Bradyrhizobium erythrophlei] SHN87536.1 SSU ribosomal protein S6P [Bradyrhizobium erythrophlei] Length = 155 Score = 64.7 bits (156), Expect = 2e-11 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 100 MPLYEHVFLARQDASTQQVDELTAQMTGIVEQ 5 MPLYEHVFLARQDASTQQV+ELTAQMTGIVEQ Sbjct: 1 MPLYEHVFLARQDASTQQVEELTAQMTGIVEQ 32 >WP_044536454.1 MULTISPECIES: 30S ribosomal protein S6 [Bradyrhizobium] KJC50957.1 30S ribosomal protein S6 [Bradyrhizobium sp. LTSP885] KJC59790.1 30S ribosomal protein S6 [Bradyrhizobium sp. LTSPM299] Length = 158 Score = 63.9 bits (154), Expect = 4e-11 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -1 Query: 100 MPLYEHVFLARQDASTQQVDELTAQMTGIVEQG 2 M LYEHVFLARQDASTQQV+ELTAQMTGIVEQG Sbjct: 1 MALYEHVFLARQDASTQQVEELTAQMTGIVEQG 33 >SHH14284.1 SSU ribosomal protein S6P [Bradyrhizobium erythrophlei] Length = 155 Score = 63.2 bits (152), Expect = 8e-11 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -1 Query: 100 MPLYEHVFLARQDASTQQVDELTAQMTGIVEQ 5 MPLYEHVFLARQDASTQQV+ELT QMTGIVEQ Sbjct: 1 MPLYEHVFLARQDASTQQVEELTTQMTGIVEQ 32 >SHG99495.1 SSU ribosomal protein S6P [Bradyrhizobium erythrophlei] Length = 157 Score = 63.2 bits (152), Expect = 8e-11 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -1 Query: 100 MPLYEHVFLARQDASTQQVDELTAQMTGIVEQ 5 MPLYEHVFLARQDASTQQV+ELT QMTGIVEQ Sbjct: 1 MPLYEHVFLARQDASTQQVEELTTQMTGIVEQ 32 >SDS35141.1 SSU ribosomal protein S6P [Bradyrhizobium canariense] Length = 157 Score = 63.2 bits (152), Expect = 8e-11 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -1 Query: 100 MPLYEHVFLARQDASTQQVDELTAQMTGIVEQ 5 MPLYEHVFLARQDASTQQV+ELT QMTGIVEQ Sbjct: 1 MPLYEHVFLARQDASTQQVEELTTQMTGIVEQ 32 >WP_029583670.1 30S ribosomal protein S6 [Bradyrhizobium sp. URHD0069] Length = 157 Score = 63.2 bits (152), Expect = 8e-11 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -1 Query: 100 MPLYEHVFLARQDASTQQVDELTAQMTGIVEQ 5 MPLYEHVFLARQDASTQQV+ELT QMTGIVEQ Sbjct: 1 MPLYEHVFLARQDASTQQVEELTTQMTGIVEQ 32 >WP_035656597.1 30S ribosomal protein S6 [Bradyrhizobium sp. STM 3809] Length = 153 Score = 62.8 bits (151), Expect = 1e-10 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -1 Query: 100 MPLYEHVFLARQDASTQQVDELTAQMTGIVE 8 MPLYEHVFLARQDASTQQV+ELTAQMTGIVE Sbjct: 1 MPLYEHVFLARQDASTQQVEELTAQMTGIVE 31 >WP_008969613.1 30S ribosomal protein S6 [Bradyrhizobium sp. STM 3843] CCE07094.1 30S ribosomal protein S6 [Bradyrhizobium sp. STM 3843] Length = 156 Score = 62.8 bits (151), Expect = 1e-10 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -1 Query: 100 MPLYEHVFLARQDASTQQVDELTAQMTGIVE 8 MPLYEHVFLARQDASTQQV+ELTAQMTGIVE Sbjct: 1 MPLYEHVFLARQDASTQQVEELTAQMTGIVE 31 >WP_006610960.1 30S ribosomal protein S6 [Bradyrhizobium sp. ORS 285] CCD85619.1 30S ribosomal protein S6 [Bradyrhizobium sp. ORS 285] Length = 159 Score = 62.8 bits (151), Expect = 1e-10 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -1 Query: 100 MPLYEHVFLARQDASTQQVDELTAQMTGIVE 8 MPLYEHVFLARQDASTQQV+ELTAQMTGIVE Sbjct: 1 MPLYEHVFLARQDASTQQVEELTAQMTGIVE 31 >WP_027583810.1 30S ribosomal protein S6 [Bradyrhizobium sp. Ai1a-2] Length = 158 Score = 61.6 bits (148), Expect = 3e-10 Identities = 30/32 (93%), Positives = 31/32 (96%) Frame = -1 Query: 100 MPLYEHVFLARQDASTQQVDELTAQMTGIVEQ 5 M LYEHVFLARQDASTQQVDELTAQ+TGIVEQ Sbjct: 1 MALYEHVFLARQDASTQQVDELTAQVTGIVEQ 32 >WP_011926260.1 MULTISPECIES: 30S ribosomal protein S6 [Bradyrhizobium] A4YT77.1 RecName: Full=30S ribosomal protein S6 CAL77103.1 30S ribosomal protein S6 [Bradyrhizobium sp. ORS 278] Length = 153 Score = 61.2 bits (147), Expect = 4e-10 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 100 MPLYEHVFLARQDASTQQVDELTAQMTGIVE 8 MPLYEHVFLARQDASTQQV+ELT QMTGIVE Sbjct: 1 MPLYEHVFLARQDASTQQVEELTTQMTGIVE 31