BLASTX nr result
ID: Glycyrrhiza30_contig00035389
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00035389 (323 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU15818.1 hypothetical protein TSUD_236340 [Trifolium subterran... 75 1e-13 KYP46145.1 putative urea active transporter 1 [Cajanus cajan] 74 4e-13 OIW10732.1 hypothetical protein TanjilG_27678 [Lupinus angustifo... 73 9e-13 XP_019445200.1 PREDICTED: urea-proton symporter DUR3 [Lupinus an... 73 9e-13 XP_016201256.1 PREDICTED: urea-proton symporter DUR3 [Arachis ip... 71 4e-12 XP_015963168.1 PREDICTED: urea-proton symporter DUR3 [Arachis du... 71 4e-12 XP_004512370.1 PREDICTED: urea-proton symporter DUR3 [Cicer arie... 70 8e-12 XP_007158133.1 hypothetical protein PHAVU_002G127200g [Phaseolus... 70 1e-11 KOM45431.1 hypothetical protein LR48_Vigan06g073700 [Vigna angul... 69 1e-11 XP_017426137.1 PREDICTED: urea-proton symporter DUR3 [Vigna angu... 69 1e-11 KHN42868.1 Putative urea active transporter 1 [Glycine soja] 69 1e-11 XP_003523904.1 PREDICTED: urea-proton symporter DUR3 [Glycine ma... 69 1e-11 XP_003612583.1 sodium:solute symporter family protein [Medicago ... 68 5e-11 XP_014519953.1 PREDICTED: urea-proton symporter DUR3 [Vigna radi... 68 5e-11 ONI05688.1 hypothetical protein PRUPE_5G019100 [Prunus persica] 67 1e-10 XP_008238045.1 PREDICTED: LOW QUALITY PROTEIN: urea-proton sympo... 65 5e-10 XP_007210322.1 hypothetical protein PRUPE_ppa002143mg [Prunus pe... 65 6e-10 XP_017180769.1 PREDICTED: urea-proton symporter DUR3-like, parti... 64 2e-09 XP_010255736.1 PREDICTED: urea-proton symporter DUR3-like [Nelum... 64 2e-09 XP_008373474.1 PREDICTED: urea-proton symporter DUR3 [Malus dome... 64 2e-09 >GAU15818.1 hypothetical protein TSUD_236340 [Trifolium subterraneum] Length = 699 Score = 75.1 bits (183), Expect = 1e-13 Identities = 33/36 (91%), Positives = 33/36 (91%) Frame = -2 Query: 112 MASPSQCPPFEFSGKYYHVSENGGNCVRQTSFFEGK 5 MAS SQCPPFEFS KYYHVSENGG CVRQTSFFEGK Sbjct: 1 MASSSQCPPFEFSSKYYHVSENGGGCVRQTSFFEGK 36 >KYP46145.1 putative urea active transporter 1 [Cajanus cajan] Length = 713 Score = 73.9 bits (180), Expect = 4e-13 Identities = 33/37 (89%), Positives = 33/37 (89%) Frame = -2 Query: 112 MASPSQCPPFEFSGKYYHVSENGGNCVRQTSFFEGKP 2 MAS S CPPFEFS KYYHVSENGG CVRQTSFFEGKP Sbjct: 1 MASASGCPPFEFSSKYYHVSENGGVCVRQTSFFEGKP 37 >OIW10732.1 hypothetical protein TanjilG_27678 [Lupinus angustifolius] Length = 699 Score = 72.8 bits (177), Expect = 9e-13 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -2 Query: 112 MASPSQCPPFEFSGKYYHVSENGGNCVRQTSFFEGKP 2 M+S CPPFEFSGKYYHVSENGG CVRQ+SFFEGKP Sbjct: 1 MSSVLHCPPFEFSGKYYHVSENGGGCVRQSSFFEGKP 37 >XP_019445200.1 PREDICTED: urea-proton symporter DUR3 [Lupinus angustifolius] Length = 713 Score = 72.8 bits (177), Expect = 9e-13 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = -2 Query: 112 MASPSQCPPFEFSGKYYHVSENGGNCVRQTSFFEGKP 2 M+S CPPFEFSGKYYHVSENGG CVRQ+SFFEGKP Sbjct: 1 MSSVLHCPPFEFSGKYYHVSENGGGCVRQSSFFEGKP 37 >XP_016201256.1 PREDICTED: urea-proton symporter DUR3 [Arachis ipaensis] Length = 712 Score = 70.9 bits (172), Expect = 4e-12 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = -2 Query: 112 MASPSQCPPFEFSGKYYHVSENGGNCVRQTSFFEGKP 2 MAS +QCPPFEFS KYYH SENGG+CVRQTSFFEGKP Sbjct: 1 MASATQCPPFEFSAKYYH-SENGGSCVRQTSFFEGKP 36 >XP_015963168.1 PREDICTED: urea-proton symporter DUR3 [Arachis duranensis] Length = 712 Score = 70.9 bits (172), Expect = 4e-12 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = -2 Query: 112 MASPSQCPPFEFSGKYYHVSENGGNCVRQTSFFEGKP 2 MAS +QCPPFEFS KYYH SENGG+CVRQTSFFEGKP Sbjct: 1 MASATQCPPFEFSAKYYH-SENGGSCVRQTSFFEGKP 36 >XP_004512370.1 PREDICTED: urea-proton symporter DUR3 [Cicer arietinum] Length = 713 Score = 70.1 bits (170), Expect = 8e-12 Identities = 30/35 (85%), Positives = 32/35 (91%) Frame = -2 Query: 109 ASPSQCPPFEFSGKYYHVSENGGNCVRQTSFFEGK 5 +S SQCPPFE+S KYYHVSEN GNCVRQTSFFEGK Sbjct: 3 SSSSQCPPFEYSSKYYHVSENEGNCVRQTSFFEGK 37 >XP_007158133.1 hypothetical protein PHAVU_002G127200g [Phaseolus vulgaris] ESW30127.1 hypothetical protein PHAVU_002G127200g [Phaseolus vulgaris] Length = 713 Score = 69.7 bits (169), Expect = 1e-11 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = -2 Query: 112 MASPSQCPPFEFSGKYYHVSENGGNCVRQTSFFEGKP 2 MAS S C PFEFS KYYHVSENGG C+RQTSFFEGKP Sbjct: 1 MASASGCSPFEFSSKYYHVSENGGVCMRQTSFFEGKP 37 >KOM45431.1 hypothetical protein LR48_Vigan06g073700 [Vigna angularis] Length = 700 Score = 69.3 bits (168), Expect = 1e-11 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = -2 Query: 112 MASPSQCPPFEFSGKYYHVSENGGNCVRQTSFFEGKP 2 MAS S C PFEFS KYYHVS+NGG CVRQTSFFEGKP Sbjct: 1 MASASGCGPFEFSSKYYHVSQNGGVCVRQTSFFEGKP 37 >XP_017426137.1 PREDICTED: urea-proton symporter DUR3 [Vigna angularis] BAT99761.1 hypothetical protein VIGAN_10127300 [Vigna angularis var. angularis] Length = 714 Score = 69.3 bits (168), Expect = 1e-11 Identities = 31/37 (83%), Positives = 32/37 (86%) Frame = -2 Query: 112 MASPSQCPPFEFSGKYYHVSENGGNCVRQTSFFEGKP 2 MAS S C PFEFS KYYHVS+NGG CVRQTSFFEGKP Sbjct: 1 MASASGCGPFEFSSKYYHVSQNGGVCVRQTSFFEGKP 37 >KHN42868.1 Putative urea active transporter 1 [Glycine soja] Length = 714 Score = 69.3 bits (168), Expect = 1e-11 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -2 Query: 97 QCPPFEFSGKYYHVSENGGNCVRQTSFFEGKP 2 +CPPFEFS KYYHVSENGG CVRQTSFFEGKP Sbjct: 7 ECPPFEFSSKYYHVSENGGVCVRQTSFFEGKP 38 >XP_003523904.1 PREDICTED: urea-proton symporter DUR3 [Glycine max] KRH62682.1 hypothetical protein GLYMA_04G123700 [Glycine max] Length = 714 Score = 69.3 bits (168), Expect = 1e-11 Identities = 29/32 (90%), Positives = 30/32 (93%) Frame = -2 Query: 97 QCPPFEFSGKYYHVSENGGNCVRQTSFFEGKP 2 +CPPFEFS KYYHVSENGG CVRQTSFFEGKP Sbjct: 7 ECPPFEFSSKYYHVSENGGVCVRQTSFFEGKP 38 >XP_003612583.1 sodium:solute symporter family protein [Medicago truncatula] AES95541.1 sodium:solute symporter family protein [Medicago truncatula] Length = 711 Score = 67.8 bits (164), Expect = 5e-11 Identities = 31/37 (83%), Positives = 31/37 (83%) Frame = -2 Query: 112 MASPSQCPPFEFSGKYYHVSENGGNCVRQTSFFEGKP 2 MAS SQCPPFEFS KYYH ENGG CVRQ SFFEGKP Sbjct: 1 MASSSQCPPFEFSSKYYH--ENGGGCVRQASFFEGKP 35 >XP_014519953.1 PREDICTED: urea-proton symporter DUR3 [Vigna radiata var. radiata] Length = 714 Score = 67.8 bits (164), Expect = 5e-11 Identities = 30/37 (81%), Positives = 32/37 (86%) Frame = -2 Query: 112 MASPSQCPPFEFSGKYYHVSENGGNCVRQTSFFEGKP 2 MAS S C PFEFS KYYHVS++GG CVRQTSFFEGKP Sbjct: 1 MASASACGPFEFSSKYYHVSQDGGVCVRQTSFFEGKP 37 >ONI05688.1 hypothetical protein PRUPE_5G019100 [Prunus persica] Length = 793 Score = 66.6 bits (161), Expect = 1e-10 Identities = 31/40 (77%), Positives = 33/40 (82%), Gaps = 2/40 (5%) Frame = -2 Query: 115 FMASP--SQCPPFEFSGKYYHVSENGGNCVRQTSFFEGKP 2 FMAS SQCPPFEFS KYYHV+ +GG CVRQTSFF GKP Sbjct: 69 FMASSWWSQCPPFEFSSKYYHVAGDGGGCVRQTSFFGGKP 108 >XP_008238045.1 PREDICTED: LOW QUALITY PROTEIN: urea-proton symporter DUR3 [Prunus mume] Length = 691 Score = 65.1 bits (157), Expect = 5e-10 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = -2 Query: 109 ASPSQCPPFEFSGKYYHVSENGGNCVRQTSFFEGKP 2 +S SQCPPFEFS KYYHV+ +GG CVRQTSFF GKP Sbjct: 3 SSWSQCPPFEFSSKYYHVAGDGGGCVRQTSFFGGKP 38 >XP_007210322.1 hypothetical protein PRUPE_ppa002143mg [Prunus persica] Length = 710 Score = 64.7 bits (156), Expect = 6e-10 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -2 Query: 100 SQCPPFEFSGKYYHVSENGGNCVRQTSFFEGKP 2 SQCPPFEFS KYYHV+ +GG CVRQTSFF GKP Sbjct: 7 SQCPPFEFSSKYYHVAGDGGGCVRQTSFFGGKP 39 >XP_017180769.1 PREDICTED: urea-proton symporter DUR3-like, partial [Malus domestica] Length = 650 Score = 63.5 bits (153), Expect = 2e-09 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -2 Query: 109 ASPSQCPPFEFSGKYYHVSENGGNCVRQTSFFEGKP 2 +S SQCPPFEFS KYYHV+ +GG CVRQ+SFF GKP Sbjct: 3 SSWSQCPPFEFSSKYYHVAGDGGGCVRQSSFFGGKP 38 >XP_010255736.1 PREDICTED: urea-proton symporter DUR3-like [Nelumbo nucifera] Length = 706 Score = 63.5 bits (153), Expect = 2e-09 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -2 Query: 109 ASPSQCPPFEFSGKYYHVSENGGNCVRQTSFFEGKP 2 +S SQCPPF FSGKYYHV++ GG CVRQ+SFFEGKP Sbjct: 3 SSSSQCPPFGFSGKYYHVAD-GGGCVRQSSFFEGKP 37 >XP_008373474.1 PREDICTED: urea-proton symporter DUR3 [Malus domestica] Length = 718 Score = 63.5 bits (153), Expect = 2e-09 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -2 Query: 109 ASPSQCPPFEFSGKYYHVSENGGNCVRQTSFFEGKP 2 +S SQCPPFEFS KYYHV+ +GG CVRQ+SFF GKP Sbjct: 3 SSWSQCPPFEFSSKYYHVAGDGGGCVRQSSFFGGKP 38