BLASTX nr result
ID: Glycyrrhiza30_contig00035212
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00035212 (255 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_003594651.1 hypothetical protein MTR_2g032950 [Medicago trunc... 51 3e-06 >XP_003594651.1 hypothetical protein MTR_2g032950 [Medicago truncatula] AES64902.1 hypothetical protein MTR_2g032950 [Medicago truncatula] Length = 127 Score = 51.2 bits (121), Expect = 3e-06 Identities = 29/54 (53%), Positives = 32/54 (59%), Gaps = 3/54 (5%) Frame = -1 Query: 255 VKTGSDRSVQ---PGIGPPPGSVNPHNRLGGEPALKPKNRLKTGKNKKNRRSSG 103 VKT R VQ PG GP G + NR G EP KP NR +TGK KNRRS+G Sbjct: 5 VKTEPARPVQSIGPGTGPMSGPSHAKNRSGREPDRKPVNRTETGKTTKNRRSNG 58