BLASTX nr result
ID: Glycyrrhiza30_contig00035168
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00035168 (246 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value NP_001296589.1 uncharacterized LOC101495589 precursor [Cicer ari... 57 1e-07 GAU41178.1 hypothetical protein TSUD_89740 [Trifolium subterraneum] 51 7e-06 >NP_001296589.1 uncharacterized LOC101495589 precursor [Cicer arietinum] CAA66108.1 specific tissue protein 1 [Cicer arietinum] Length = 312 Score = 56.6 bits (135), Expect = 1e-07 Identities = 24/36 (66%), Positives = 32/36 (88%) Frame = -2 Query: 245 PRPSVTKYDDNSYYKSEKPHMNNEFEPRPSITKYDN 138 PRPSVTKYD + YYK++K +N+EFEPRPS+T+YD+ Sbjct: 128 PRPSVTKYDGD-YYKNKKSQLNDEFEPRPSVTRYDD 162 Score = 53.1 bits (126), Expect = 2e-06 Identities = 23/36 (63%), Positives = 30/36 (83%) Frame = -2 Query: 245 PRPSVTKYDDNSYYKSEKPHMNNEFEPRPSITKYDN 138 PRPSVTKYD Y K++K +N+EFEPRPS+T+YD+ Sbjct: 203 PRPSVTKYDGGDY-KNKKSRVNSEFEPRPSVTRYDD 237 >GAU41178.1 hypothetical protein TSUD_89740 [Trifolium subterraneum] Length = 191 Score = 51.2 bits (121), Expect = 7e-06 Identities = 24/35 (68%), Positives = 27/35 (77%) Frame = -2 Query: 245 PRPSVTKYDDNSYYKSEKPHMNNEFEPRPSITKYD 141 P PS+TKYD + YKS K +NNEFEP PSITKYD Sbjct: 119 PIPSMTKYDGDDGYKSVKLPVNNEFEPIPSITKYD 153