BLASTX nr result
ID: Glycyrrhiza30_contig00035128
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00035128 (284 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_007139167.1 hypothetical protein PHAVU_008G007000g [Phaseolus... 57 5e-09 >XP_007139167.1 hypothetical protein PHAVU_008G007000g [Phaseolus vulgaris] ESW11161.1 hypothetical protein PHAVU_008G007000g [Phaseolus vulgaris] Length = 69 Score = 57.4 bits (137), Expect = 5e-09 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = -1 Query: 107 VRMMNKNGIMVAHALGHKMTGSCCFHDCPLLVF 9 V++M+KN IM AH LGHKMTG+CCFH CPL V+ Sbjct: 15 VKVMDKNDIMQAHVLGHKMTGNCCFHGCPLPVY 47