BLASTX nr result
ID: Glycyrrhiza30_contig00035083
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00035083 (245 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_019422844.1 PREDICTED: pentatricopeptide repeat-containing pr... 147 9e-41 KOM46255.1 hypothetical protein LR48_Vigan06g156100 [Vigna angul... 140 2e-40 GAU22227.1 hypothetical protein TSUD_227630 [Trifolium subterran... 144 3e-39 XP_007153010.1 hypothetical protein PHAVU_003G000100g [Phaseolus... 144 3e-39 KYP32626.1 Pentatricopeptide repeat-containing protein At5g15300... 139 8e-39 XP_015571974.1 PREDICTED: pentatricopeptide repeat-containing pr... 139 1e-38 XP_016200372.1 PREDICTED: pentatricopeptide repeat-containing pr... 140 3e-38 XP_003598017.1 PPR containing plant-like protein [Medicago trunc... 140 5e-38 XP_017426969.1 PREDICTED: pentatricopeptide repeat-containing pr... 140 7e-38 XP_014520545.1 PREDICTED: pentatricopeptide repeat-containing pr... 140 7e-38 XP_015966126.1 PREDICTED: pentatricopeptide repeat-containing pr... 140 7e-38 ONI08706.1 hypothetical protein PRUPE_5G195700 [Prunus persica] 137 2e-37 KHN44640.1 Pentatricopeptide repeat-containing protein [Glycine ... 138 2e-37 XP_006593838.1 PREDICTED: pentatricopeptide repeat-containing pr... 138 3e-37 XP_007210182.1 hypothetical protein PRUPE_ppa020166mg [Prunus pe... 137 4e-37 XP_012080291.1 PREDICTED: pentatricopeptide repeat-containing pr... 137 5e-37 XP_008374561.1 PREDICTED: pentatricopeptide repeat-containing pr... 137 7e-37 XP_010093596.1 hypothetical protein L484_006484 [Morus notabilis... 137 1e-36 CBI15206.3 unnamed protein product, partial [Vitis vinifera] 135 1e-36 XP_004508136.1 PREDICTED: pentatricopeptide repeat-containing pr... 136 2e-36 >XP_019422844.1 PREDICTED: pentatricopeptide repeat-containing protein At1g59720, chloroplastic/mitochondrial-like [Lupinus angustifolius] OIV93228.1 hypothetical protein TanjilG_27407 [Lupinus angustifolius] Length = 463 Score = 147 bits (372), Expect = 9e-41 Identities = 64/81 (79%), Positives = 76/81 (93%) Frame = +2 Query: 2 DEGRRYFDIMKRDYNIQPTIKHYGCMVDLLGRAGLVEEAYKLIKNMPVECINAIVWRILL 181 DEGR+YFDIM R+YNIQPT+KHYGCMVDL GRAGL++E Y+LIK MPVEC+NAIVWR LL Sbjct: 329 DEGRKYFDIMIREYNIQPTMKHYGCMVDLFGRAGLLDEGYRLIKEMPVECVNAIVWRTLL 388 Query: 182 AACRLHGNIELGEKVREHLIE 244 AACR+HGN+ELGEKVR+H++E Sbjct: 389 AACRIHGNVELGEKVRKHVLE 409 >KOM46255.1 hypothetical protein LR48_Vigan06g156100 [Vigna angularis] Length = 202 Score = 140 bits (353), Expect = 2e-40 Identities = 66/81 (81%), Positives = 73/81 (90%) Frame = +2 Query: 2 DEGRRYFDIMKRDYNIQPTIKHYGCMVDLLGRAGLVEEAYKLIKNMPVECINAIVWRILL 181 DEGR+ DIM R YNIQPTIKHYGCMVDLLGRAGLV++AY LIKNMPVEC NAIVWR LL Sbjct: 59 DEGRQCIDIMDRYYNIQPTIKHYGCMVDLLGRAGLVDDAYNLIKNMPVEC-NAIVWRTLL 117 Query: 182 AACRLHGNIELGEKVREHLIE 244 AACRLHGN++LGEK+R HL+E Sbjct: 118 AACRLHGNVQLGEKIRNHLLE 138 >GAU22227.1 hypothetical protein TSUD_227630 [Trifolium subterraneum] Length = 465 Score = 144 bits (362), Expect = 3e-39 Identities = 67/81 (82%), Positives = 76/81 (93%) Frame = +2 Query: 2 DEGRRYFDIMKRDYNIQPTIKHYGCMVDLLGRAGLVEEAYKLIKNMPVECINAIVWRILL 181 DEGRRYFDIM RDYNIQPTIKHYGCMVDLLGRAGLV EAY+LIK+MP+EC NAI+WR LL Sbjct: 323 DEGRRYFDIMCRDYNIQPTIKHYGCMVDLLGRAGLVVEAYRLIKSMPIEC-NAIIWRTLL 381 Query: 182 AACRLHGNIELGEKVREHLIE 244 AACR++GN+ELGEKVR+ L+E Sbjct: 382 AACRIYGNVELGEKVRKQLLE 402 >XP_007153010.1 hypothetical protein PHAVU_003G000100g [Phaseolus vulgaris] ESW25004.1 hypothetical protein PHAVU_003G000100g [Phaseolus vulgaris] Length = 478 Score = 144 bits (362), Expect = 3e-39 Identities = 66/81 (81%), Positives = 74/81 (91%) Frame = +2 Query: 2 DEGRRYFDIMKRDYNIQPTIKHYGCMVDLLGRAGLVEEAYKLIKNMPVECINAIVWRILL 181 DEGR++ DIM RDYNIQPT KHYGCMVDLLGRAGLV++AY LIKNMPVEC NAIVWR LL Sbjct: 337 DEGRKWIDIMDRDYNIQPTTKHYGCMVDLLGRAGLVDDAYNLIKNMPVEC-NAIVWRTLL 395 Query: 182 AACRLHGNIELGEKVREHLIE 244 AACRLHGN++LGEK+R HL+E Sbjct: 396 AACRLHGNVQLGEKIRNHLLE 416 >KYP32626.1 Pentatricopeptide repeat-containing protein At5g15300 family [Cajanus cajan] Length = 306 Score = 139 bits (350), Expect = 8e-39 Identities = 67/81 (82%), Positives = 72/81 (88%) Frame = +2 Query: 2 DEGRRYFDIMKRDYNIQPTIKHYGCMVDLLGRAGLVEEAYKLIKNMPVECINAIVWRILL 181 +E RRY DIM R YNIQPTIKHYGCMVDLLGRAGLVEEAY LIK+MPVEC NAIVWR LL Sbjct: 180 EESRRYIDIMGRKYNIQPTIKHYGCMVDLLGRAGLVEEAYNLIKSMPVEC-NAIVWRTLL 238 Query: 182 AACRLHGNIELGEKVREHLIE 244 ACRLHG +ELGEKVR+HL+E Sbjct: 239 VACRLHGCVELGEKVRKHLLE 259 >XP_015571974.1 PREDICTED: pentatricopeptide repeat-containing protein At5g56310 [Ricinus communis] Length = 301 Score = 139 bits (349), Expect = 1e-38 Identities = 63/81 (77%), Positives = 73/81 (90%) Frame = +2 Query: 2 DEGRRYFDIMKRDYNIQPTIKHYGCMVDLLGRAGLVEEAYKLIKNMPVECINAIVWRILL 181 DEGRR+FDIM ++Y+IQPTIKHYGCMVD+LGRAG VEEAY LI +MP+EC N I+WR LL Sbjct: 166 DEGRRFFDIMNKEYHIQPTIKHYGCMVDILGRAGFVEEAYGLISSMPMEC-NPIIWRTLL 224 Query: 182 AACRLHGNIELGEKVREHLIE 244 AACRLHGN+ELGEKVR HL+E Sbjct: 225 AACRLHGNVELGEKVRRHLLE 245 >XP_016200372.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Arachis ipaensis] Length = 452 Score = 140 bits (354), Expect = 3e-38 Identities = 64/81 (79%), Positives = 76/81 (93%) Frame = +2 Query: 2 DEGRRYFDIMKRDYNIQPTIKHYGCMVDLLGRAGLVEEAYKLIKNMPVECINAIVWRILL 181 +EGRRYFD+M R+YNIQPT+KHYGCMVDLLGRAGLVEEAY+LIK+MP+EC +A+VWR LL Sbjct: 331 EEGRRYFDVMNREYNIQPTMKHYGCMVDLLGRAGLVEEAYRLIKSMPMEC-DAVVWRTLL 389 Query: 182 AACRLHGNIELGEKVREHLIE 244 AACR+HGNI LG+KVR HL+E Sbjct: 390 AACRVHGNILLGKKVRSHLLE 410 >XP_003598017.1 PPR containing plant-like protein [Medicago truncatula] AES68268.1 PPR containing plant-like protein [Medicago truncatula] Length = 479 Score = 140 bits (354), Expect = 5e-38 Identities = 66/81 (81%), Positives = 75/81 (92%) Frame = +2 Query: 2 DEGRRYFDIMKRDYNIQPTIKHYGCMVDLLGRAGLVEEAYKLIKNMPVECINAIVWRILL 181 DEGRRYF+IM RDYNI+PTIKHYGCMVDLLGRAGL EAY+LIK+MPVEC NAI+WR LL Sbjct: 337 DEGRRYFEIMNRDYNIKPTIKHYGCMVDLLGRAGLFVEAYELIKSMPVEC-NAIIWRTLL 395 Query: 182 AACRLHGNIELGEKVREHLIE 244 AACR +GN+ELGEKVR+HL+E Sbjct: 396 AACRNYGNVELGEKVRKHLME 416 >XP_017426969.1 PREDICTED: pentatricopeptide repeat-containing protein At1g59720, chloroplastic/mitochondrial-like [Vigna angularis] BAT98863.1 hypothetical protein VIGAN_10022000 [Vigna angularis var. angularis] Length = 480 Score = 140 bits (353), Expect = 7e-38 Identities = 66/81 (81%), Positives = 73/81 (90%) Frame = +2 Query: 2 DEGRRYFDIMKRDYNIQPTIKHYGCMVDLLGRAGLVEEAYKLIKNMPVECINAIVWRILL 181 DEGR+ DIM R YNIQPTIKHYGCMVDLLGRAGLV++AY LIKNMPVEC NAIVWR LL Sbjct: 337 DEGRQCIDIMDRYYNIQPTIKHYGCMVDLLGRAGLVDDAYNLIKNMPVEC-NAIVWRTLL 395 Query: 182 AACRLHGNIELGEKVREHLIE 244 AACRLHGN++LGEK+R HL+E Sbjct: 396 AACRLHGNVQLGEKIRNHLLE 416 >XP_014520545.1 PREDICTED: pentatricopeptide repeat-containing protein At1g59720, chloroplastic/mitochondrial-like [Vigna radiata var. radiata] Length = 480 Score = 140 bits (353), Expect = 7e-38 Identities = 66/81 (81%), Positives = 73/81 (90%) Frame = +2 Query: 2 DEGRRYFDIMKRDYNIQPTIKHYGCMVDLLGRAGLVEEAYKLIKNMPVECINAIVWRILL 181 DEGR+ DIM R YNIQPTIKHYGCMVDLLGRAGLV++AY LIKNMPVEC NAIVWR LL Sbjct: 337 DEGRQCIDIMDRYYNIQPTIKHYGCMVDLLGRAGLVDDAYNLIKNMPVEC-NAIVWRTLL 395 Query: 182 AACRLHGNIELGEKVREHLIE 244 AACRLHGN++LGEK+R HL+E Sbjct: 396 AACRLHGNVQLGEKIRNHLLE 416 >XP_015966126.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Arachis duranensis] Length = 464 Score = 140 bits (352), Expect = 7e-38 Identities = 63/81 (77%), Positives = 76/81 (93%) Frame = +2 Query: 2 DEGRRYFDIMKRDYNIQPTIKHYGCMVDLLGRAGLVEEAYKLIKNMPVECINAIVWRILL 181 +EGRRYFD+M R+YN+QPT+KHYGCMVDLLGRAGLVEEAY+LIK+MP+EC +A+VWR LL Sbjct: 331 EEGRRYFDVMNREYNLQPTMKHYGCMVDLLGRAGLVEEAYRLIKSMPMEC-DAVVWRTLL 389 Query: 182 AACRLHGNIELGEKVREHLIE 244 AACR+HGNI LG+KVR HL+E Sbjct: 390 AACRVHGNILLGKKVRSHLLE 410 >ONI08706.1 hypothetical protein PRUPE_5G195700 [Prunus persica] Length = 406 Score = 137 bits (346), Expect = 2e-37 Identities = 61/81 (75%), Positives = 75/81 (92%) Frame = +2 Query: 2 DEGRRYFDIMKRDYNIQPTIKHYGCMVDLLGRAGLVEEAYKLIKNMPVECINAIVWRILL 181 DEGRRYFD+M ++Y+IQPT+KHYGCMVD+LGRAG VEEAY LI++MP+EC NAIVWR LL Sbjct: 271 DEGRRYFDVMSKEYHIQPTMKHYGCMVDMLGRAGYVEEAYNLIRSMPMEC-NAIVWRALL 329 Query: 182 AACRLHGNIELGEKVREHLIE 244 AAC++HG++ELGEKVR HL+E Sbjct: 330 AACQVHGDVELGEKVRSHLLE 350 >KHN44640.1 Pentatricopeptide repeat-containing protein [Glycine soja] Length = 454 Score = 138 bits (348), Expect = 2e-37 Identities = 65/81 (80%), Positives = 73/81 (90%) Frame = +2 Query: 2 DEGRRYFDIMKRDYNIQPTIKHYGCMVDLLGRAGLVEEAYKLIKNMPVECINAIVWRILL 181 DE RR DIM RDYNIQPTIKHYGC+VDLLGRAGLVE+AY LIKNMP+EC NA+VWR LL Sbjct: 312 DESRRCIDIMGRDYNIQPTIKHYGCVVDLLGRAGLVEDAYNLIKNMPIEC-NAVVWRTLL 370 Query: 182 AACRLHGNIELGEKVREHLIE 244 AACRL G++ELGEKVR+HL+E Sbjct: 371 AACRLQGHVELGEKVRKHLLE 391 >XP_006593838.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Glycine max] XP_006593839.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Glycine max] KRH17575.1 hypothetical protein GLYMA_13G001700 [Glycine max] Length = 478 Score = 138 bits (348), Expect = 3e-37 Identities = 65/81 (80%), Positives = 73/81 (90%) Frame = +2 Query: 2 DEGRRYFDIMKRDYNIQPTIKHYGCMVDLLGRAGLVEEAYKLIKNMPVECINAIVWRILL 181 DE RR DIM RDYNIQPTIKHYGC+VDLLGRAGLVE+AY LIKNMP+EC NA+VWR LL Sbjct: 336 DESRRCIDIMGRDYNIQPTIKHYGCVVDLLGRAGLVEDAYNLIKNMPIEC-NAVVWRTLL 394 Query: 182 AACRLHGNIELGEKVREHLIE 244 AACRL G++ELGEKVR+HL+E Sbjct: 395 AACRLQGHVELGEKVRKHLLE 415 >XP_007210182.1 hypothetical protein PRUPE_ppa020166mg [Prunus persica] Length = 443 Score = 137 bits (346), Expect = 4e-37 Identities = 61/81 (75%), Positives = 75/81 (92%) Frame = +2 Query: 2 DEGRRYFDIMKRDYNIQPTIKHYGCMVDLLGRAGLVEEAYKLIKNMPVECINAIVWRILL 181 DEGRRYFD+M ++Y+IQPT+KHYGCMVD+LGRAG VEEAY LI++MP+EC NAIVWR LL Sbjct: 308 DEGRRYFDVMSKEYHIQPTMKHYGCMVDMLGRAGYVEEAYNLIRSMPMEC-NAIVWRALL 366 Query: 182 AACRLHGNIELGEKVREHLIE 244 AAC++HG++ELGEKVR HL+E Sbjct: 367 AACQVHGDVELGEKVRSHLLE 387 >XP_012080291.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21065 [Jatropha curcas] KDP31272.1 hypothetical protein JCGZ_11648 [Jatropha curcas] Length = 451 Score = 137 bits (346), Expect = 5e-37 Identities = 62/81 (76%), Positives = 76/81 (93%) Frame = +2 Query: 2 DEGRRYFDIMKRDYNIQPTIKHYGCMVDLLGRAGLVEEAYKLIKNMPVECINAIVWRILL 181 DEGRRYFD+M ++Y+I+PTIKHYGCMVD+LGRAG V EAY+LI++MP+EC NAIVWRI L Sbjct: 317 DEGRRYFDMMSKEYHIKPTIKHYGCMVDILGRAGFVVEAYELIRSMPMEC-NAIVWRISL 375 Query: 182 AACRLHGNIELGEKVREHLIE 244 AACRLHGN+ELGE+VR+HL+E Sbjct: 376 AACRLHGNVELGEQVRKHLLE 396 >XP_008374561.1 PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Malus domestica] Length = 455 Score = 137 bits (345), Expect = 7e-37 Identities = 62/81 (76%), Positives = 72/81 (88%) Frame = +2 Query: 2 DEGRRYFDIMKRDYNIQPTIKHYGCMVDLLGRAGLVEEAYKLIKNMPVECINAIVWRILL 181 DEGRRYFD+M ++Y IQPT+KHYGCMVD+LGRAG VEEAY+LIKNMP+EC NA+ WR LL Sbjct: 329 DEGRRYFDVMSKEYRIQPTMKHYGCMVDMLGRAGYVEEAYRLIKNMPMEC-NAVTWRTLL 387 Query: 182 AACRLHGNIELGEKVREHLIE 244 ACRLHG+I LGEKVR HL+E Sbjct: 388 GACRLHGDIVLGEKVRGHLLE 408 >XP_010093596.1 hypothetical protein L484_006484 [Morus notabilis] EXB54324.1 hypothetical protein L484_006484 [Morus notabilis] Length = 523 Score = 137 bits (346), Expect = 1e-36 Identities = 61/80 (76%), Positives = 76/80 (95%) Frame = +2 Query: 2 DEGRRYFDIMKRDYNIQPTIKHYGCMVDLLGRAGLVEEAYKLIKNMPVECINAIVWRILL 181 DEGRRYFD+M + Y+++PT+KHYGCMVD+LGRAGL+EEAY+LIK+MP++C NAIVWR LL Sbjct: 373 DEGRRYFDMMSKLYHVKPTVKHYGCMVDMLGRAGLLEEAYQLIKSMPMKC-NAIVWRTLL 431 Query: 182 AACRLHGNIELGEKVREHLI 241 AACR+HGNIELGEKVREH++ Sbjct: 432 AACRIHGNIELGEKVREHIL 451 >CBI15206.3 unnamed protein product, partial [Vitis vinifera] Length = 416 Score = 135 bits (341), Expect = 1e-36 Identities = 63/81 (77%), Positives = 75/81 (92%) Frame = +2 Query: 2 DEGRRYFDIMKRDYNIQPTIKHYGCMVDLLGRAGLVEEAYKLIKNMPVECINAIVWRILL 181 +EGRRYFDIM+RDYNIQPTIKHYG MVD+LGRAGLVEEAY+LIK+MP+E N+IVWR LL Sbjct: 271 EEGRRYFDIMRRDYNIQPTIKHYGSMVDILGRAGLVEEAYRLIKSMPIES-NSIVWRTLL 329 Query: 182 AACRLHGNIELGEKVREHLIE 244 AACR+HGN+EL E+VR+ L+E Sbjct: 330 AACRVHGNLELAEQVRQQLLE 350 >XP_004508136.1 PREDICTED: pentatricopeptide repeat-containing protein At1g59720, mitochondrial-like [Cicer arietinum] XP_004508137.1 PREDICTED: pentatricopeptide repeat-containing protein At1g59720, mitochondrial-like [Cicer arietinum] XP_004508138.1 PREDICTED: pentatricopeptide repeat-containing protein At1g59720, mitochondrial-like [Cicer arietinum] XP_004508139.1 PREDICTED: pentatricopeptide repeat-containing protein At1g59720, mitochondrial-like [Cicer arietinum] Length = 471 Score = 136 bits (343), Expect = 2e-36 Identities = 63/81 (77%), Positives = 75/81 (92%) Frame = +2 Query: 2 DEGRRYFDIMKRDYNIQPTIKHYGCMVDLLGRAGLVEEAYKLIKNMPVECINAIVWRILL 181 DEGR+YFDIM ++YNI+PTIKHYGCMVDLLGRAGLV EAY+LIK+M +EC NAI+WR LL Sbjct: 336 DEGRQYFDIMIKEYNIKPTIKHYGCMVDLLGRAGLVVEAYRLIKHMSIEC-NAIIWRTLL 394 Query: 182 AACRLHGNIELGEKVREHLIE 244 AACR +GN+ELGEKVR+HL+E Sbjct: 395 AACRSYGNVELGEKVRKHLLE 415