BLASTX nr result
ID: Glycyrrhiza30_contig00034555
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00034555 (242 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value KHN28549.1 Pentatricopeptide repeat-containing protein [Glycine ... 70 3e-12 XP_007161694.1 hypothetical protein PHAVU_001G090600g [Phaseolus... 70 3e-12 XP_017423075.1 PREDICTED: pentatricopeptide repeat-containing pr... 68 1e-11 XP_006604178.1 PREDICTED: pentatricopeptide repeat-containing pr... 67 3e-11 XP_019454741.1 PREDICTED: pentatricopeptide repeat-containing pr... 65 2e-10 XP_014499608.1 PREDICTED: pentatricopeptide repeat-containing pr... 58 4e-08 GAU11906.1 hypothetical protein TSUD_195290 [Trifolium subterran... 55 7e-07 >KHN28549.1 Pentatricopeptide repeat-containing protein [Glycine soja] Length = 444 Score = 70.1 bits (170), Expect = 3e-12 Identities = 33/52 (63%), Positives = 39/52 (75%) Frame = +2 Query: 86 SNPLRPYHKHLANQALVAVIKDRPFDAVHSSPGAPPWTSTAVTEVLRSIARF 241 +N LR +HKHLA+Q LV VIKD PFDA P PPWT+ AVTEVLR I+R+ Sbjct: 4 TNSLRHFHKHLASQTLVLVIKDLPFDAHSPPPSPPPWTNDAVTEVLRLISRY 55 >XP_007161694.1 hypothetical protein PHAVU_001G090600g [Phaseolus vulgaris] XP_007161695.1 hypothetical protein PHAVU_001G090600g [Phaseolus vulgaris] ESW33688.1 hypothetical protein PHAVU_001G090600g [Phaseolus vulgaris] ESW33689.1 hypothetical protein PHAVU_001G090600g [Phaseolus vulgaris] Length = 445 Score = 70.1 bits (170), Expect = 3e-12 Identities = 34/54 (62%), Positives = 41/54 (75%), Gaps = 2/54 (3%) Frame = +2 Query: 86 SNPLRPYHKHLANQALVAVIKDRPFDA--VHSSPGAPPWTSTAVTEVLRSIARF 241 +NP+R +H+HLANQ LV VIKD PFDA SP PWT+ AVTEVLRSI+R+ Sbjct: 4 TNPVRHFHRHLANQVLVLVIKDLPFDAHPPQPSPSGAPWTNDAVTEVLRSISRY 57 >XP_017423075.1 PREDICTED: pentatricopeptide repeat-containing protein At1g77405 [Vigna angularis] KOM43068.1 hypothetical protein LR48_Vigan05g067200 [Vigna angularis] BAT92841.1 hypothetical protein VIGAN_07168600 [Vigna angularis var. angularis] Length = 445 Score = 68.2 bits (165), Expect = 1e-11 Identities = 34/54 (62%), Positives = 41/54 (75%), Gaps = 2/54 (3%) Frame = +2 Query: 86 SNPLRPYHKHLANQALVAVIKDRPFDA--VHSSPGAPPWTSTAVTEVLRSIARF 241 +NP+R ++KHL NQ LV VIKD PFDA SP A PWT+ AVTEVLRSI+R+ Sbjct: 4 TNPVRHFNKHLTNQVLVLVIKDLPFDAPPPSPSPSAAPWTNDAVTEVLRSISRY 57 >XP_006604178.1 PREDICTED: pentatricopeptide repeat-containing protein At1g77405-like [Glycine max] KRG94641.1 hypothetical protein GLYMA_19G099200 [Glycine max] Length = 446 Score = 67.0 bits (162), Expect = 3e-11 Identities = 34/54 (62%), Positives = 40/54 (74%), Gaps = 2/54 (3%) Frame = +2 Query: 86 SNPLRPYHKHLANQALVAVIKDRPFDA--VHSSPGAPPWTSTAVTEVLRSIARF 241 +N LR +HKHLA+Q LV VIKD PFDA SP PPWT+ AVTEVLR I+R+ Sbjct: 4 TNSLRHFHKHLASQTLVLVIKDLPFDAHPPPPSPSPPPWTNDAVTEVLRLISRY 57 >XP_019454741.1 PREDICTED: pentatricopeptide repeat-containing protein At1g77405 [Lupinus angustifolius] OIW04507.1 hypothetical protein TanjilG_13889 [Lupinus angustifolius] Length = 449 Score = 64.7 bits (156), Expect = 2e-10 Identities = 33/57 (57%), Positives = 40/57 (70%), Gaps = 3/57 (5%) Frame = +2 Query: 80 MTSNPLRPYHKHLANQALVAVIKDRPFDAVHSSPGA---PPWTSTAVTEVLRSIARF 241 +T+ LR YHKHL NQ LVA+IKD PFDA SP + P WT + V+EVLRSI R+ Sbjct: 2 ITTLSLRHYHKHLVNQTLVAIIKDLPFDAHSPSPNSDTIPSWTVSTVSEVLRSIPRY 58 >XP_014499608.1 PREDICTED: pentatricopeptide repeat-containing protein At1g77405 [Vigna radiata var. radiata] Length = 440 Score = 58.2 bits (139), Expect = 4e-08 Identities = 30/52 (57%), Positives = 37/52 (71%) Frame = +2 Query: 86 SNPLRPYHKHLANQALVAVIKDRPFDAVHSSPGAPPWTSTAVTEVLRSIARF 241 +NP R ++KHLANQ LV VIKD P + SP WT+ AVTEVLRSI+R+ Sbjct: 4 TNPARHFNKHLANQVLVLVIKDLP---LPPSPSPASWTNDAVTEVLRSISRY 52 >GAU11906.1 hypothetical protein TSUD_195290 [Trifolium subterraneum] Length = 432 Score = 54.7 bits (130), Expect = 7e-07 Identities = 31/50 (62%), Positives = 38/50 (76%), Gaps = 1/50 (2%) Frame = +2 Query: 95 LRPYHKHL-ANQALVAVIKDRPFDAVHSSPGAPPWTSTAVTEVLRSIARF 241 LRPY+K L A QALVAVIKD PFD+ ++ + WT AVTE+LRSI+RF Sbjct: 5 LRPYNKQLLAKQALVAVIKDIPFDSSYNP--SITWTPDAVTEILRSISRF 52