BLASTX nr result
ID: Glycyrrhiza30_contig00034261
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00034261 (247 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013453184.1 hypothetical protein MTR_6g088780 [Medicago trunc... 57 1e-08 >XP_013453184.1 hypothetical protein MTR_6g088780 [Medicago truncatula] KEH27212.1 hypothetical protein MTR_6g088780 [Medicago truncatula] Length = 138 Score = 57.4 bits (137), Expect = 1e-08 Identities = 32/63 (50%), Positives = 42/63 (66%) Frame = -3 Query: 245 RIERLEALVRFLLKQLIPNLDEEAVDNIMTHTLGDDNSAAPQSSISTQCSRYEKFGQEDH 66 R+E E+L++ +L Q PNL ++ VDN+M H LG NSAA SSIST EKFG ED+ Sbjct: 77 RMEAYESLLKCVLVQQNPNLSDDDVDNMMGHALGIANSAAHHSSISTHVP--EKFGSEDY 134 Query: 65 SQD 57 Q+ Sbjct: 135 LQE 137