BLASTX nr result
ID: Glycyrrhiza30_contig00034244
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00034244 (315 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013460359.1 MFS transporter [Medicago truncatula] KEH34392.1 ... 55 5e-07 >XP_013460359.1 MFS transporter [Medicago truncatula] KEH34392.1 MFS transporter [Medicago truncatula] Length = 162 Score = 54.7 bits (130), Expect = 5e-07 Identities = 28/46 (60%), Positives = 32/46 (69%), Gaps = 5/46 (10%) Frame = -3 Query: 163 LKHDT-----KARFGLMVWDGTGVKWNGMSICSIVWIIKKGMEWNG 41 LK+DT KA FGLM DG ++W+GM CSIVW KKGMEWNG Sbjct: 118 LKNDTPTAVPKAMFGLMESDG--MEWSGMEPCSIVWFCKKGMEWNG 161