BLASTX nr result
ID: Glycyrrhiza30_contig00034048
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00034048 (718 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_010088771.1 hypothetical protein L484_018330 [Morus notabilis... 92 5e-19 GAU19252.1 hypothetical protein TSUD_335350 [Trifolium subterran... 90 4e-17 KVH93809.1 hypothetical protein Ccrd_004133 [Cynara cardunculus ... 74 1e-13 AFK47445.1 unknown [Lotus japonicus] 72 4e-13 YP_173361.1 hypothetical protein NitaMp013 [Nicotiana tabacum] B... 70 6e-12 KJB09786.1 hypothetical protein B456_001G165900 [Gossypium raimo... 55 7e-11 GAU19251.1 hypothetical protein TSUD_335340 [Trifolium subterran... 65 2e-08 >XP_010088771.1 hypothetical protein L484_018330 [Morus notabilis] EXB36954.1 hypothetical protein L484_018330 [Morus notabilis] Length = 217 Score = 91.7 bits (226), Expect = 5e-19 Identities = 40/41 (97%), Positives = 40/41 (97%) Frame = -2 Query: 717 PHCWKGSASKPYVELPPHTAPLGMEVGPAQACAVKVVVHDL 595 PHCWKGSASKPYVELPPHTAPLGMEVGP QACAVKVVVHDL Sbjct: 56 PHCWKGSASKPYVELPPHTAPLGMEVGPTQACAVKVVVHDL 96 >GAU19252.1 hypothetical protein TSUD_335350 [Trifolium subterraneum] Length = 552 Score = 90.1 bits (222), Expect = 4e-17 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = -2 Query: 717 PHCWKGSASKPYVELPPHTAPLGMEVGPAQACAVKVVVHD 598 PHCWKGSASKPYVELPPHTAPLGMEVGPAQACAVKVVVH+ Sbjct: 503 PHCWKGSASKPYVELPPHTAPLGMEVGPAQACAVKVVVHE 542 >KVH93809.1 hypothetical protein Ccrd_004133 [Cynara cardunculus var. scolymus] Length = 93 Score = 73.9 bits (180), Expect = 1e-13 Identities = 32/35 (91%), Positives = 32/35 (91%) Frame = -2 Query: 717 PHCWKGSASKPYVELPPHTAPLGMEVGPAQACAVK 613 PHCWKGS SKPYVELP H APLGMEVGPAQACAVK Sbjct: 8 PHCWKGSTSKPYVELPLHMAPLGMEVGPAQACAVK 42 >AFK47445.1 unknown [Lotus japonicus] Length = 81 Score = 72.4 bits (176), Expect = 4e-13 Identities = 33/40 (82%), Positives = 36/40 (90%) Frame = -2 Query: 474 MDLYSISNQRISPNEEFPLLCFRAARAWHSLLAERHTGKK 355 MDLYSI NQRISPN EFPL CFR+ARAWHSLLAERHT ++ Sbjct: 1 MDLYSIRNQRISPNYEFPLHCFRSARAWHSLLAERHTEER 40 >YP_173361.1 hypothetical protein NitaMp013 [Nicotiana tabacum] BAD83424.1 hypothetical protein (mitochondrion) [Nicotiana tabacum] Length = 112 Score = 70.1 bits (170), Expect = 6e-12 Identities = 36/45 (80%), Positives = 38/45 (84%), Gaps = 2/45 (4%) Frame = -2 Query: 474 MDLYSISNQRISPN--EEFPLLCFRAARAWHSLLAERHTGKKERL 346 MDLYSI NQRISP EEFPLL F +ARAWHSLLAERHT KK+RL Sbjct: 1 MDLYSIRNQRISPQKREEFPLLSFCSARAWHSLLAERHTEKKKRL 45 >KJB09786.1 hypothetical protein B456_001G165900 [Gossypium raimondii] Length = 285 Score = 54.7 bits (130), Expect(2) = 7e-11 Identities = 26/29 (89%), Positives = 26/29 (89%) Frame = +1 Query: 367 MPLREQGVPRTSGAKTKQGEFFVGRNPLI 453 MPLREQGVP TSGAKTKQGEF VG NPLI Sbjct: 1 MPLREQGVPWTSGAKTKQGEFLVGGNPLI 29 Score = 40.4 bits (93), Expect(2) = 7e-11 Identities = 19/24 (79%), Positives = 21/24 (87%) Frame = +2 Query: 494 LGQNSQMSLSLLQPSFLMSKTRSW 565 LGQN MS+SLLQP FLMSKTRS+ Sbjct: 30 LGQNDHMSVSLLQPFFLMSKTRSY 53 >GAU19251.1 hypothetical protein TSUD_335340 [Trifolium subterraneum] Length = 491 Score = 64.7 bits (156), Expect = 2e-08 Identities = 26/28 (92%), Positives = 27/28 (96%) Frame = -2 Query: 717 PHCWKGSASKPYVELPPHTAPLGMEVGP 634 PHCWKGSASKPYVELPPHTAPLGME+ P Sbjct: 389 PHCWKGSASKPYVELPPHTAPLGMEMSP 416