BLASTX nr result
ID: Glycyrrhiza30_contig00034024
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00034024 (220 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value XP_013442215.1 NB-ARC domain disease resistance protein, putativ... 82 1e-16 CAC86495.1 RGA-F protein, partial [Cicer arietinum] 75 2e-15 XP_004498673.1 PREDICTED: putative disease resistance RPP13-like... 75 3e-14 XP_003598489.1 LRR and NB-ARC domain disease resistance protein ... 73 2e-13 XP_003598093.2 NB-ARC domain disease resistance protein [Medicag... 72 6e-13 KYP41963.1 Putative disease resistance RPP13-like protein 1 [Caj... 72 6e-13 XP_003598501.1 LRR and NB-ARC domain disease resistance protein ... 70 2e-12 XP_003598504.1 LRR and NB-ARC domain disease resistance protein ... 70 2e-12 XP_013466896.1 NB-ARC domain disease resistance protein [Medicag... 69 4e-12 KYP41054.1 Putative disease resistance RPP13-like protein 1 [Caj... 69 4e-12 KYP41066.1 Putative disease resistance RPP13-like protein 1 [Caj... 69 4e-12 XP_003598466.1 LRR and NB-ARC domain disease resistance protein ... 69 4e-12 XP_003598492.1 LRR and NB-ARC domain disease resistance protein ... 67 2e-11 KYP59764.1 Putative disease resistance RPP13-like protein 1 [Caj... 67 4e-11 AFM54560.1 putative resistance protein non-TIR 38, partial [Phas... 64 4e-11 XP_013466886.1 LRR and NB-ARC domain disease resistance protein ... 66 5e-11 GAU28266.1 hypothetical protein TSUD_118730 [Trifolium subterran... 64 3e-10 AAU89636.1 resistance protein-like protein, partial [Citrus trif... 61 6e-10 AAR08868.1 resistance protein candidate, partial [Vitis riparia] 61 1e-09 XP_003598494.2 LRR and NB-ARC domain disease resistance protein ... 62 1e-09 >XP_013442215.1 NB-ARC domain disease resistance protein, putative, partial [Medicago truncatula] KEH16240.1 NB-ARC domain disease resistance protein, putative, partial [Medicago truncatula] Length = 1982 Score = 82.4 bits (202), Expect = 1e-16 Identities = 41/65 (63%), Positives = 49/65 (75%), Gaps = 5/65 (7%) Frame = -2 Query: 180 LKSITSKAFDNNNLSS-----VAPKRIDTSDLNTLQVQLKQSLSHKKFLLVLDDIWYGSY 16 L+S+T K D NN+++ V K DT DLNTLQVQL+QSL HK+FLLVLDD+W GSY Sbjct: 237 LESVTFKTIDANNMNTMHTEFVTSKITDTGDLNTLQVQLQQSLIHKRFLLVLDDMWDGSY 296 Query: 15 VDWNN 1 VDWNN Sbjct: 297 VDWNN 301 >CAC86495.1 RGA-F protein, partial [Cicer arietinum] Length = 185 Score = 75.5 bits (184), Expect = 2e-15 Identities = 37/61 (60%), Positives = 46/61 (75%), Gaps = 1/61 (1%) Frame = -2 Query: 180 LKSITSKAFDNN-NLSSVAPKRIDTSDLNTLQVQLKQSLSHKKFLLVLDDIWYGSYVDWN 4 L+S T ++ D + V +R DTSDLN LQVQL+Q+L+HK FLLVLDD+W GSYVDWN Sbjct: 44 LESATLESIDTTIHTEFVTSRRTDTSDLNNLQVQLQQNLNHKTFLLVLDDMWDGSYVDWN 103 Query: 3 N 1 N Sbjct: 104 N 104 >XP_004498673.1 PREDICTED: putative disease resistance RPP13-like protein 1 isoform X1 [Cicer arietinum] XP_004498674.1 PREDICTED: putative disease resistance RPP13-like protein 1 isoform X2 [Cicer arietinum] Length = 1238 Score = 75.5 bits (184), Expect = 3e-14 Identities = 37/61 (60%), Positives = 46/61 (75%), Gaps = 1/61 (1%) Frame = -2 Query: 180 LKSITSKAFDNN-NLSSVAPKRIDTSDLNTLQVQLKQSLSHKKFLLVLDDIWYGSYVDWN 4 L+S T ++ D + V +R DTSDLN LQVQL+Q+L+HK FLLVLDD+W GSYVDWN Sbjct: 237 LESATLESIDTTIHTEFVTSRRTDTSDLNNLQVQLQQNLNHKTFLLVLDDMWDGSYVDWN 296 Query: 3 N 1 N Sbjct: 297 N 297 >XP_003598489.1 LRR and NB-ARC domain disease resistance protein [Medicago truncatula] AES68740.1 LRR and NB-ARC domain disease resistance protein [Medicago truncatula] Length = 1342 Score = 73.2 bits (178), Expect = 2e-13 Identities = 37/48 (77%), Positives = 38/48 (79%), Gaps = 1/48 (2%) Frame = -2 Query: 141 LSSVAPKRIDTSDLNTLQVQLKQSLSHKKFLLVLDDIWYGSYVD-WNN 1 L SV KR DT DLN LQVQL+QSL KKFLLVLDDIWYG YVD WNN Sbjct: 247 LQSVTSKRNDTDDLNILQVQLQQSLRSKKFLLVLDDIWYGKYVDCWNN 294 >XP_003598093.2 NB-ARC domain disease resistance protein [Medicago truncatula] AES68344.2 NB-ARC domain disease resistance protein [Medicago truncatula] Length = 1069 Score = 71.6 bits (174), Expect = 6e-13 Identities = 35/65 (53%), Positives = 46/65 (70%), Gaps = 5/65 (7%) Frame = -2 Query: 180 LKSITSKAFDNNNLSSV-----APKRIDTSDLNTLQVQLKQSLSHKKFLLVLDDIWYGSY 16 ++S TS+ D NN ++ KR DT+DLNTLQV+L++ + HKKFLLVLDDIW Y Sbjct: 148 VESFTSETIDTNNHNTPHAEFSPSKRTDTNDLNTLQVRLQRIIRHKKFLLVLDDIWDRHY 207 Query: 15 VDWNN 1 +DWNN Sbjct: 208 IDWNN 212 >KYP41963.1 Putative disease resistance RPP13-like protein 1 [Cajanus cajan] Length = 1071 Score = 71.6 bits (174), Expect = 6e-13 Identities = 33/47 (70%), Positives = 38/47 (80%) Frame = -2 Query: 141 LSSVAPKRIDTSDLNTLQVQLKQSLSHKKFLLVLDDIWYGSYVDWNN 1 L SV K IDT +LN Q +LK+SLSHK+FL+VLDDIW GSYVDWNN Sbjct: 243 LESVTYKSIDTDNLNIFQEKLKESLSHKRFLIVLDDIWDGSYVDWNN 289 >XP_003598501.1 LRR and NB-ARC domain disease resistance protein [Medicago truncatula] AES68752.1 LRR and NB-ARC domain disease resistance protein [Medicago truncatula] Length = 829 Score = 70.5 bits (171), Expect = 2e-12 Identities = 35/48 (72%), Positives = 39/48 (81%), Gaps = 1/48 (2%) Frame = -2 Query: 141 LSSVAPKRIDTSDLNTLQVQLKQSLSHKKFLLVLDDIWYGSYVD-WNN 1 L SV KR DT DLN LQV+L+Q LS+ KFLLVLDDIWYG+YVD WNN Sbjct: 246 LESVTSKRNDTDDLNILQVKLQQCLSNTKFLLVLDDIWYGNYVDCWNN 293 >XP_003598504.1 LRR and NB-ARC domain disease resistance protein [Medicago truncatula] AES68755.1 LRR and NB-ARC domain disease resistance protein [Medicago truncatula] Length = 1319 Score = 70.1 bits (170), Expect = 2e-12 Identities = 33/47 (70%), Positives = 37/47 (78%) Frame = -2 Query: 141 LSSVAPKRIDTSDLNTLQVQLKQSLSHKKFLLVLDDIWYGSYVDWNN 1 L SV ++ T+DLN LQVQL+QSL KKFLLVLDDIWYG YV WNN Sbjct: 248 LESVTSEKTTTNDLNGLQVQLQQSLRDKKFLLVLDDIWYGRYVGWNN 294 >XP_013466896.1 NB-ARC domain disease resistance protein [Medicago truncatula] KEH40937.1 NB-ARC domain disease resistance protein [Medicago truncatula] Length = 376 Score = 69.3 bits (168), Expect = 4e-12 Identities = 31/47 (65%), Positives = 40/47 (85%) Frame = -2 Query: 141 LSSVAPKRIDTSDLNTLQVQLKQSLSHKKFLLVLDDIWYGSYVDWNN 1 L S+ K +DT++LN LQV+L+QSL +++FLLVLDDIW GSYVDWNN Sbjct: 251 LESITFKPVDTNNLNILQVELQQSLRNRRFLLVLDDIWDGSYVDWNN 297 >KYP41054.1 Putative disease resistance RPP13-like protein 1 [Cajanus cajan] Length = 993 Score = 69.3 bits (168), Expect = 4e-12 Identities = 33/47 (70%), Positives = 38/47 (80%) Frame = -2 Query: 141 LSSVAPKRIDTSDLNTLQVQLKQSLSHKKFLLVLDDIWYGSYVDWNN 1 L SV K DT++LN LQV+L+QSL K+FLLVLDDIW GSYVDWNN Sbjct: 250 LESVTFKPFDTNNLNILQVELQQSLIQKRFLLVLDDIWNGSYVDWNN 296 >KYP41066.1 Putative disease resistance RPP13-like protein 1 [Cajanus cajan] Length = 1173 Score = 69.3 bits (168), Expect = 4e-12 Identities = 33/47 (70%), Positives = 38/47 (80%) Frame = -2 Query: 141 LSSVAPKRIDTSDLNTLQVQLKQSLSHKKFLLVLDDIWYGSYVDWNN 1 L SV K DT++LN LQV+L+QSL K+FLLVLDDIW GSYVDWNN Sbjct: 250 LESVTFKPFDTNNLNILQVELQQSLIQKRFLLVLDDIWNGSYVDWNN 296 >XP_003598466.1 LRR and NB-ARC domain disease resistance protein [Medicago truncatula] AES68717.1 LRR and NB-ARC domain disease resistance protein [Medicago truncatula] Length = 1216 Score = 69.3 bits (168), Expect = 4e-12 Identities = 31/47 (65%), Positives = 40/47 (85%) Frame = -2 Query: 141 LSSVAPKRIDTSDLNTLQVQLKQSLSHKKFLLVLDDIWYGSYVDWNN 1 L S+ K +DT++LN LQV+L+QSL +++FLLVLDDIW GSYVDWNN Sbjct: 251 LESITFKPVDTNNLNILQVELQQSLRNRRFLLVLDDIWDGSYVDWNN 297 >XP_003598492.1 LRR and NB-ARC domain disease resistance protein [Medicago truncatula] AES68743.1 LRR and NB-ARC domain disease resistance protein [Medicago truncatula] Length = 1291 Score = 67.4 bits (163), Expect = 2e-11 Identities = 34/48 (70%), Positives = 37/48 (77%), Gaps = 1/48 (2%) Frame = -2 Query: 141 LSSVAPKRIDTSDLNTLQVQLKQSLSHKKFLLVLDDIWYGSYVD-WNN 1 L SV KR DT LN LQVQL+QSL KKFLL+LDDIWYG YV+ WNN Sbjct: 247 LESVTSKRNDTDALNILQVQLQQSLRSKKFLLLLDDIWYGKYVECWNN 294 >KYP59764.1 Putative disease resistance RPP13-like protein 1 [Cajanus cajan] Length = 1060 Score = 66.6 bits (161), Expect = 4e-11 Identities = 35/59 (59%), Positives = 44/59 (74%), Gaps = 5/59 (8%) Frame = -2 Query: 165 SKAFD-----NNNLSSVAPKRIDTSDLNTLQVQLKQSLSHKKFLLVLDDIWYGSYVDWN 4 SK FD + L SV+ K + T++LNTLQV+L+QSL +K+FLLVLDDIW GSY DWN Sbjct: 237 SKDFDVCKVTKSLLESVSSKPVVTNNLNTLQVELQQSLCNKRFLLVLDDIWDGSYNDWN 295 >AFM54560.1 putative resistance protein non-TIR 38, partial [Phaseolus vulgaris] Length = 158 Score = 63.9 bits (154), Expect = 4e-11 Identities = 30/47 (63%), Positives = 37/47 (78%) Frame = -2 Query: 141 LSSVAPKRIDTSDLNTLQVQLKQSLSHKKFLLVLDDIWYGSYVDWNN 1 L SV + ++ + LQVQLKQSLS+KKFLLVLDDIWYG+YV WN+ Sbjct: 38 LESVTVGTMKDTNFDKLQVQLKQSLSNKKFLLVLDDIWYGNYVGWNS 84 >XP_013466886.1 LRR and NB-ARC domain disease resistance protein [Medicago truncatula] KEH40927.1 LRR and NB-ARC domain disease resistance protein [Medicago truncatula] Length = 1503 Score = 66.2 bits (160), Expect = 5e-11 Identities = 34/48 (70%), Positives = 37/48 (77%), Gaps = 1/48 (2%) Frame = -2 Query: 141 LSSVAPKRIDTSDLNTLQVQLKQSLSHKKFLLVLDDIWYGSYVD-WNN 1 L SV KR DT LN LQVQL+QSL KKFLLVLDDIW+G YVD WN+ Sbjct: 247 LESVTSKRNDTDALNILQVQLQQSLRSKKFLLVLDDIWHGKYVDCWNS 294 >GAU28266.1 hypothetical protein TSUD_118730 [Trifolium subterraneum] Length = 1345 Score = 63.9 bits (154), Expect = 3e-10 Identities = 32/48 (66%), Positives = 35/48 (72%), Gaps = 1/48 (2%) Frame = -2 Query: 141 LSSVAPKRIDTSDLNTLQVQLKQSLSHKKFLLVLDDIWYGSYVD-WNN 1 L S KR DT DLN LQ +L Q LS+ KFLLVLDD+WYG YVD WNN Sbjct: 248 LESFTSKRNDTDDLNILQQELLQRLSNTKFLLVLDDMWYGKYVDCWNN 295 >AAU89636.1 resistance protein-like protein, partial [Citrus trifoliata] Length = 171 Score = 61.2 bits (147), Expect = 6e-10 Identities = 28/45 (62%), Positives = 33/45 (73%) Frame = -2 Query: 141 LSSVAPKRIDTSDLNTLQVQLKQSLSHKKFLLVLDDIWYGSYVDW 7 LSS+ + +D SDLN LQ +LK LS KKFLLVLDD+W SY DW Sbjct: 44 LSSITKQTVDNSDLNLLQEELKMQLSRKKFLLVLDDVWNESYNDW 88 >AAR08868.1 resistance protein candidate, partial [Vitis riparia] Length = 179 Score = 60.8 bits (146), Expect = 1e-09 Identities = 26/47 (55%), Positives = 36/47 (76%) Frame = -2 Query: 141 LSSVAPKRIDTSDLNTLQVQLKQSLSHKKFLLVLDDIWYGSYVDWNN 1 LS ++P+ D+ + N LQV+L QSL+ K+FLLVLDD+W +Y DWNN Sbjct: 46 LSDISPQSNDSKNFNRLQVELSQSLAGKRFLLVLDDVWNRNYEDWNN 92 >XP_003598494.2 LRR and NB-ARC domain disease resistance protein [Medicago truncatula] AES68745.2 LRR and NB-ARC domain disease resistance protein [Medicago truncatula] Length = 1354 Score = 62.4 bits (150), Expect = 1e-09 Identities = 28/47 (59%), Positives = 36/47 (76%) Frame = -2 Query: 141 LSSVAPKRIDTSDLNTLQVQLKQSLSHKKFLLVLDDIWYGSYVDWNN 1 L SV ++ ++LN LQV+L+QSL +K FLLVLDDIWYG YV WN+ Sbjct: 246 LESVTSEKTTANELNILQVKLQQSLRNKSFLLVLDDIWYGRYVGWNS 292