BLASTX nr result
ID: Glycyrrhiza30_contig00033782
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Glycyrrhiza30_contig00033782 (345 letters) Database: ./nr 115,041,592 sequences; 42,171,959,267 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value GAU24794.1 hypothetical protein TSUD_157070 [Trifolium subterran... 78 8e-16 XP_004508989.1 PREDICTED: ras-related protein RABH1b-like [Cicer... 78 2e-15 XP_013457538.1 RAB GTPase-like protein B1C [Medicago truncatula]... 77 6e-15 XP_003549965.2 PREDICTED: ras-related protein RABH1b [Glycine ma... 77 6e-15 AFK37167.1 unknown [Medicago truncatula] 77 6e-15 XP_019422269.1 PREDICTED: ras-related protein RABH1b-like [Lupin... 76 9e-15 XP_007156620.1 hypothetical protein PHAVU_002G003800g [Phaseolus... 74 5e-14 BAU00379.1 hypothetical protein VIGAN_10196600 [Vigna angularis ... 73 5e-14 KYP37016.1 Ras-related protein RABH1B [Cajanus cajan] 73 1e-13 XP_014520337.1 PREDICTED: ras-related protein RABH1b-like [Vigna... 73 1e-13 KOM32495.1 hypothetical protein LR48_Vigan01g205100 [Vigna angul... 72 3e-13 KOM32494.1 hypothetical protein LR48_Vigan01g205000 [Vigna angul... 70 4e-13 XP_007155742.1 hypothetical protein PHAVU_003G227800g [Phaseolus... 72 5e-13 XP_017413139.1 PREDICTED: ras-related protein RABH1b-like [Vigna... 70 5e-13 XP_014505853.1 PREDICTED: ras-related protein RABH1b-like [Vigna... 71 7e-13 KRH77257.1 hypothetical protein GLYMA_01G202400 [Glycine max] 70 1e-12 XP_019423140.1 PREDICTED: ras-related protein RABH1b [Lupinus an... 70 1e-12 BAT75765.1 hypothetical protein VIGAN_01368100 [Vigna angularis ... 70 1e-12 KHN42637.1 Ras-related protein RABH1b [Glycine soja] 70 2e-12 XP_004511760.1 PREDICTED: ras-related protein RABH1b [Cicer arie... 68 1e-11 >GAU24794.1 hypothetical protein TSUD_157070 [Trifolium subterraneum] Length = 156 Score = 77.8 bits (190), Expect = 8e-16 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -3 Query: 343 LPGMETLSTTKQEDMVDVNLRSSASHDSQPQSGGCAC 233 LPGMETLS+TKQEDMVDVNLRSSASHDSQPQSGGCAC Sbjct: 120 LPGMETLSSTKQEDMVDVNLRSSASHDSQPQSGGCAC 156 >XP_004508989.1 PREDICTED: ras-related protein RABH1b-like [Cicer arietinum] Length = 206 Score = 78.2 bits (191), Expect = 2e-15 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = -3 Query: 343 LPGMETLSTTKQEDMVDVNLRSSASHDSQPQSGGCAC 233 LPGMETLSTTKQEDMVDVNLRSSASHDSQPQSGGC+C Sbjct: 170 LPGMETLSTTKQEDMVDVNLRSSASHDSQPQSGGCSC 206 >XP_013457538.1 RAB GTPase-like protein B1C [Medicago truncatula] KEH31569.1 RAB GTPase-like protein B1C [Medicago truncatula] Length = 206 Score = 76.6 bits (187), Expect = 6e-15 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -3 Query: 343 LPGMETLSTTKQEDMVDVNLRSSASHDSQPQSGGCAC 233 LPGMETLSTTKQEDMVDVNLRSS SHDSQPQSGGC+C Sbjct: 170 LPGMETLSTTKQEDMVDVNLRSSTSHDSQPQSGGCSC 206 >XP_003549965.2 PREDICTED: ras-related protein RABH1b [Glycine max] XP_014630796.1 PREDICTED: uncharacterized protein LOC100527651 isoform X1 [Glycine max] KHN01660.1 Ras-related protein RABH1b [Glycine soja] KHN21041.1 Ras-related protein RABH1b [Glycine soja] KRH04283.1 hypothetical protein GLYMA_17G151600 [Glycine max] KRH57563.1 hypothetical protein GLYMA_05G068900 [Glycine max] Length = 206 Score = 76.6 bits (187), Expect = 6e-15 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -3 Query: 343 LPGMETLSTTKQEDMVDVNLRSSASHDSQPQSGGCAC 233 LPGMETLSTTKQEDMVDVNLRSS SHDSQPQSGGC+C Sbjct: 170 LPGMETLSTTKQEDMVDVNLRSSGSHDSQPQSGGCSC 206 >AFK37167.1 unknown [Medicago truncatula] Length = 206 Score = 76.6 bits (187), Expect = 6e-15 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -3 Query: 343 LPGMETLSTTKQEDMVDVNLRSSASHDSQPQSGGCAC 233 LPGMETLSTTKQEDMVDVNLRSS SHDSQPQSGGC+C Sbjct: 170 LPGMETLSTTKQEDMVDVNLRSSTSHDSQPQSGGCSC 206 >XP_019422269.1 PREDICTED: ras-related protein RABH1b-like [Lupinus angustifolius] OIV94651.1 hypothetical protein TanjilG_25875 [Lupinus angustifolius] Length = 206 Score = 76.3 bits (186), Expect = 9e-15 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = -3 Query: 343 LPGMETLSTTKQEDMVDVNLRSSASHDSQPQSGGCAC 233 LPGMETLS+TKQEDMVDVNLRSSA HDSQPQSGGCAC Sbjct: 170 LPGMETLSSTKQEDMVDVNLRSSAGHDSQPQSGGCAC 206 >XP_007156620.1 hypothetical protein PHAVU_002G003800g [Phaseolus vulgaris] ESW28614.1 hypothetical protein PHAVU_002G003800g [Phaseolus vulgaris] Length = 206 Score = 74.3 bits (181), Expect = 5e-14 Identities = 34/37 (91%), Positives = 35/37 (94%) Frame = -3 Query: 343 LPGMETLSTTKQEDMVDVNLRSSASHDSQPQSGGCAC 233 LPGMETLS+TKQEDMVDVNLRSSA HDSQP SGGCAC Sbjct: 170 LPGMETLSSTKQEDMVDVNLRSSAGHDSQPDSGGCAC 206 >BAU00379.1 hypothetical protein VIGAN_10196600 [Vigna angularis var. angularis] Length = 156 Score = 73.2 bits (178), Expect = 5e-14 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -3 Query: 343 LPGMETLSTTKQEDMVDVNLRSSASHDSQPQSGGCAC 233 LPGMETLS+TKQ+DMVDVNLRSSA HDSQP SGGCAC Sbjct: 120 LPGMETLSSTKQDDMVDVNLRSSAGHDSQPDSGGCAC 156 >KYP37016.1 Ras-related protein RABH1B [Cajanus cajan] Length = 206 Score = 73.2 bits (178), Expect = 1e-13 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = -3 Query: 343 LPGMETLSTTKQEDMVDVNLRSSASHDSQPQSGGCAC 233 LPGMETLST+KQEDMVDVNLRSS HDSQPQ GGCAC Sbjct: 170 LPGMETLSTSKQEDMVDVNLRSSGGHDSQPQEGGCAC 206 >XP_014520337.1 PREDICTED: ras-related protein RABH1b-like [Vigna radiata var. radiata] XP_017427313.1 PREDICTED: ras-related protein RABH1b-like [Vigna angularis] Length = 206 Score = 73.2 bits (178), Expect = 1e-13 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -3 Query: 343 LPGMETLSTTKQEDMVDVNLRSSASHDSQPQSGGCAC 233 LPGMETLS+TKQ+DMVDVNLRSSA HDSQP SGGCAC Sbjct: 170 LPGMETLSSTKQDDMVDVNLRSSAGHDSQPDSGGCAC 206 >KOM32495.1 hypothetical protein LR48_Vigan01g205100 [Vigna angularis] Length = 206 Score = 72.4 bits (176), Expect = 3e-13 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -3 Query: 343 LPGMETLSTTKQEDMVDVNLRSSASHDSQPQSGGCAC 233 LPGMETLSTTKQEDMVDVNLRSS +HDSQ +SGGCAC Sbjct: 170 LPGMETLSTTKQEDMVDVNLRSSGNHDSQSESGGCAC 206 >KOM32494.1 hypothetical protein LR48_Vigan01g205000 [Vigna angularis] Length = 147 Score = 70.5 bits (171), Expect = 4e-13 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = -3 Query: 343 LPGMETLSTTKQEDMVDVNLRSSASHDSQPQSGGCAC 233 LPGMETLS TKQEDMVDVNLRSS +HDSQ +SGGCAC Sbjct: 111 LPGMETLSNTKQEDMVDVNLRSSGNHDSQSESGGCAC 147 >XP_007155742.1 hypothetical protein PHAVU_003G227800g [Phaseolus vulgaris] ESW27736.1 hypothetical protein PHAVU_003G227800g [Phaseolus vulgaris] Length = 206 Score = 71.6 bits (174), Expect = 5e-13 Identities = 33/37 (89%), Positives = 34/37 (91%) Frame = -3 Query: 343 LPGMETLSTTKQEDMVDVNLRSSASHDSQPQSGGCAC 233 LPGMETLS TKQEDMVDVNLRSS +HDSQ QSGGCAC Sbjct: 170 LPGMETLSATKQEDMVDVNLRSSGNHDSQSQSGGCAC 206 >XP_017413139.1 PREDICTED: ras-related protein RABH1b-like [Vigna angularis] Length = 156 Score = 70.5 bits (171), Expect = 5e-13 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = -3 Query: 343 LPGMETLSTTKQEDMVDVNLRSSASHDSQPQSGGCAC 233 LPGMETLS TKQEDMVDVNLRSS +HDSQ +SGGCAC Sbjct: 120 LPGMETLSNTKQEDMVDVNLRSSGNHDSQSESGGCAC 156 >XP_014505853.1 PREDICTED: ras-related protein RABH1b-like [Vigna radiata var. radiata] Length = 206 Score = 71.2 bits (173), Expect = 7e-13 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = -3 Query: 343 LPGMETLSTTKQEDMVDVNLRSSASHDSQPQSGGCAC 233 LPGMETLSTTKQEDMVDVNLRSS +HDSQ ++GGCAC Sbjct: 170 LPGMETLSTTKQEDMVDVNLRSSGNHDSQSEAGGCAC 206 >KRH77257.1 hypothetical protein GLYMA_01G202400 [Glycine max] Length = 176 Score = 70.1 bits (170), Expect = 1e-12 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = -3 Query: 343 LPGMETLSTTKQEDMVDVNLRSSASHDSQPQSGGCAC 233 LPGMETLS+TKQEDMVDVNLRSS + SQPQSGGCAC Sbjct: 140 LPGMETLSSTKQEDMVDVNLRSSGGYQSQPQSGGCAC 176 >XP_019423140.1 PREDICTED: ras-related protein RABH1b [Lupinus angustifolius] OIV92805.1 hypothetical protein TanjilG_00939 [Lupinus angustifolius] Length = 206 Score = 70.5 bits (171), Expect = 1e-12 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = -3 Query: 343 LPGMETLSTTKQEDMVDVNLRSSASHDSQPQSGGCAC 233 LPGMETLS+TKQEDMVDVNLRSSA + SQPQSGGCAC Sbjct: 170 LPGMETLSSTKQEDMVDVNLRSSAGNASQPQSGGCAC 206 >BAT75765.1 hypothetical protein VIGAN_01368100 [Vigna angularis var. angularis] Length = 206 Score = 70.5 bits (171), Expect = 1e-12 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = -3 Query: 343 LPGMETLSTTKQEDMVDVNLRSSASHDSQPQSGGCAC 233 LPGMETLS TKQEDMVDVNLRSS +HDSQ +SGGCAC Sbjct: 170 LPGMETLSNTKQEDMVDVNLRSSGNHDSQSESGGCAC 206 >KHN42637.1 Ras-related protein RABH1b [Glycine soja] Length = 206 Score = 70.1 bits (170), Expect = 2e-12 Identities = 32/37 (86%), Positives = 34/37 (91%) Frame = -3 Query: 343 LPGMETLSTTKQEDMVDVNLRSSASHDSQPQSGGCAC 233 LPGMETLS+TKQEDMVDVNLRSS + SQPQSGGCAC Sbjct: 170 LPGMETLSSTKQEDMVDVNLRSSGGYQSQPQSGGCAC 206 >XP_004511760.1 PREDICTED: ras-related protein RABH1b [Cicer arietinum] Length = 206 Score = 68.2 bits (165), Expect = 1e-11 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = -3 Query: 343 LPGMETLSTTKQEDMVDVNLRSSASHDSQPQSGGCAC 233 LPGMETLS+TKQED+VDVNL+SS HDSQ QSGGC+C Sbjct: 170 LPGMETLSSTKQEDLVDVNLKSSGGHDSQTQSGGCSC 206